<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.1//EN"
"http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd">
<html xmlns="http://www.w3.org/1999/xhtml">
<head><meta http-equiv="content-type" content="text/html; charset=utf-8" />
<title>[174618] trunk/LayoutTests</title>
</head>
<body>
<style type="text/css"><!--
#msg dl.meta { border: 1px #006 solid; background: #369; padding: 6px; color: #fff; }
#msg dl.meta dt { float: left; width: 6em; font-weight: bold; }
#msg dt:after { content:':';}
#msg dl, #msg dt, #msg ul, #msg li, #header, #footer, #logmsg { font-family: verdana,arial,helvetica,sans-serif; font-size: 10pt; }
#msg dl a { font-weight: bold}
#msg dl a:link { color:#fc3; }
#msg dl a:active { color:#ff0; }
#msg dl a:visited { color:#cc6; }
h3 { font-family: verdana,arial,helvetica,sans-serif; font-size: 10pt; font-weight: bold; }
#msg pre { overflow: auto; background: #ffc; border: 1px #fa0 solid; padding: 6px; }
#logmsg { background: #ffc; border: 1px #fa0 solid; padding: 1em 1em 0 1em; }
#logmsg p, #logmsg pre, #logmsg blockquote { margin: 0 0 1em 0; }
#logmsg p, #logmsg li, #logmsg dt, #logmsg dd { line-height: 14pt; }
#logmsg h1, #logmsg h2, #logmsg h3, #logmsg h4, #logmsg h5, #logmsg h6 { margin: .5em 0; }
#logmsg h1:first-child, #logmsg h2:first-child, #logmsg h3:first-child, #logmsg h4:first-child, #logmsg h5:first-child, #logmsg h6:first-child { margin-top: 0; }
#logmsg ul, #logmsg ol { padding: 0; list-style-position: inside; margin: 0 0 0 1em; }
#logmsg ul { text-indent: -1em; padding-left: 1em; }#logmsg ol { text-indent: -1.5em; padding-left: 1.5em; }
#logmsg > ul, #logmsg > ol { margin: 0 0 1em 0; }
#logmsg pre { background: #eee; padding: 1em; }
#logmsg blockquote { border: 1px solid #fa0; border-left-width: 10px; padding: 1em 1em 0 1em; background: white;}
#logmsg dl { margin: 0; }
#logmsg dt { font-weight: bold; }
#logmsg dd { margin: 0; padding: 0 0 0.5em 0; }
#logmsg dd:before { content:'\00bb';}
#logmsg table { border-spacing: 0px; border-collapse: collapse; border-top: 4px solid #fa0; border-bottom: 1px solid #fa0; background: #fff; }
#logmsg table th { text-align: left; font-weight: normal; padding: 0.2em 0.5em; border-top: 1px dotted #fa0; }
#logmsg table td { text-align: right; border-top: 1px dotted #fa0; padding: 0.2em 0.5em; }
#logmsg table thead th { text-align: center; border-bottom: 1px solid #fa0; }
#logmsg table th.Corner { text-align: left; }
#logmsg hr { border: none 0; border-top: 2px dashed #fa0; height: 1px; }
#header, #footer { color: #fff; background: #636; border: 1px #300 solid; padding: 6px; }
#patch { width: 100%; }
#patch h4 {font-family: verdana,arial,helvetica,sans-serif;font-size:10pt;padding:8px;background:#369;color:#fff;margin:0;}
#patch .propset h4, #patch .binary h4 {margin:0;}
#patch pre {padding:0;line-height:1.2em;margin:0;}
#patch .diff {width:100%;background:#eee;padding: 0 0 10px 0;overflow:auto;}
#patch .propset .diff, #patch .binary .diff {padding:10px 0;}
#patch span {display:block;padding:0 10px;}
#patch .modfile, #patch .addfile, #patch .delfile, #patch .propset, #patch .binary, #patch .copfile {border:1px solid #ccc;margin:10px 0;}
#patch ins {background:#dfd;text-decoration:none;display:block;padding:0 10px;}
#patch del {background:#fdd;text-decoration:none;display:block;padding:0 10px;}
#patch .lines, .info {color:#888;background:#fff;}
--></style>
<div id="msg">
<dl class="meta">
<dt>Revision</dt> <dd><a href="http://trac.webkit.org/projects/webkit/changeset/174618">174618</a></dd>
<dt>Author</dt> <dd>simon.fraser@apple.com</dd>
<dt>Date</dt> <dd>2014-10-10 16:04:22 -0700 (Fri, 10 Oct 2014)</dd>
</dl>
<h3>Log Message</h3>
<pre>iOS Simulator results for fast/events tests.
* platform/ios-simulator/fast/events/*: Added</pre>
<h3>Modified Paths</h3>
<ul>
<li><a href="#trunkLayoutTestsChangeLog">trunk/LayoutTests/ChangeLog</a></li>
</ul>
<h3>Added Paths</h3>
<ul>
<li>trunk/LayoutTests/platform/ios-simulator/fast/encoding/</li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfastencodingdenormalisedvoicedjapanesecharsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/encoding/denormalised-voiced-japanese-chars-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfastencodinginvalidUTF8expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/encoding/invalid-UTF-8-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfastencodingutf16bigendianexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/encoding/utf-16-big-endian-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfastencodingutf16littleendianexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/encoding/utf-16-little-endian-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfastencodingxmacromanencodingtestexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/encoding/xmacroman-encoding-test-expected.txt</a></li>
<li>trunk/LayoutTests/platform/ios-simulator/fast/events/</li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfastevents5056619expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/5056619-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsanchorimagescrolledxyexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/anchor-image-scrolled-x-y-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsarrownavigationexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/arrow-navigation-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsattemptscrollwithnoscrollbarsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/attempt-scroll-with-no-scrollbars-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsautoscrollinoverflowhiddenhtmlexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-overflow-hidden-html-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsautoscrollintextareaexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-textarea-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsautoscrollintextfieldexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-textfield-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsautoscrollnonscrollableiframeinscrollabledivexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-nonscrollable-iframe-in-scrollable-div-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsautoscrollshouldnotstoponkeypressexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-should-not-stop-on-keypress-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsbackspacenavigatesbackexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/backspace-navigates-back-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsbeforeloadinputtimecrashexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/beforeload-input-time-crash-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsbogusdropEffecteffectAllowedexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/bogus-dropEffect-effectAllowed-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventscheckdefocuseventorderwhentriggeredbymouseclickexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/check-defocus-event-order-when-triggered-by-mouse-click-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventscheckdefocuseventorderwhentriggeredbytabexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/check-defocus-event-order-when-triggered-by-tab-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsclickcountexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/click-count-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsclickfocusanchorexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/click-focus-anchor-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsclickfocuscontrolexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/click-focus-control-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsclientXYinzoomandscrollexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/clientXY-in-zoom-and-scroll-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsclipboarddataTransferItemListexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/clipboard-dataTransferItemList-expected.txt</a></li>
<li>trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/</li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsconstructorsmediastreameventconstructorexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/media-stream-event-constructor-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsconstructorsmouseeventconstructorexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/mouse-event-constructor-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsconstructorswheeleventconstructorexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/wheel-event-constructor-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventscontentchangedduringdropexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/content-changed-during-drop-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventscontextnodeselectexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/context-no-deselect-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventscontextonmousedowneventexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/context-onmousedown-event-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventscontextmenuscrolledpagewithframeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/contextmenu-scrolled-page-with-frame-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventscontinuousplatformwheeleventinscrollingdivexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/continuous-platform-wheelevent-in-scrolling-div-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventscontrolclicknoonclickexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/controlclick-no-onclick-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventscrashonmutateduringdropexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/crash-on-mutate-during-drop-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdatatransferfilesattributeidentityexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/data-transfer-files-attribute-identity-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdblclickaddEventListenerexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/dblclick-addEventListener-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdocumentelementFromPointexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/document-elementFromPoint-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdomactivatesetsunderlyingclickeventashandledexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/domactivate-sets-underlying-click-event-as-handled-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdraganddropautoscrollexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-autoscroll-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdraganddropautoscrollinnerframeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-autoscroll-inner-frame-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdraganddropdataTransfertypesnocrashexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-dataTransfer-types-nocrash-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdraganddropexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdraganddropfiredragdragoverexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-fire-drag-dragover-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdraganddropsetdragdataargumentsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-set-drag-data-arguments-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdraganddropsubframedataTransferexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-subframe-dataTransfer-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdragcustomDataexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-customData-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdragdataTransferItemListexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-dataTransferItemList-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdragdataTransferItemListfilehandlingexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-dataTransferItemList-file-handling-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdragdisplaynoneelementexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-display-none-element-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdragfilecrashexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-file-crash-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdragimagefilenameexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-image-filename-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdraginframesexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-in-frames-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdraglinkexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-link-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdragoutsidewindowexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-outside-window-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdragparentnodeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-parent-node-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdragselectsimageexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-selects-image-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdragtonavigateexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drag-to-navigate-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdrophandlershouldnotstopnavigateexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drop-handler-should-not-stop-navigate-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdropwithfilepathsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/drop-with-file-paths-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdropzone001expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-001-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdropzone002expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-002-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdropzone003expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-003-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdropzone004expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-004-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsdropzone005expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-005-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventseventattributeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/event-attribute-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventseventlisteneronlinkexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/event-listener-on-link-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsfileinputhiddeninondropexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/file-input-hidden-in-ondrop-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsfiremousedownwhilepressingmousebuttonexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/fire-mousedown-while-pressing-mouse-button-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsfirescrolleventexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/fire-scroll-event-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsfocuschangecrashexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/focus-change-crash-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsframescrollfakemousemoveexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/frame-scroll-fake-mouse-move-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsframetabfocusexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/frame-tab-focus-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsimecompositionevents001expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/ime-composition-events-001-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsinputelementdisplaynoneindragleavecrashexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/input-element-display-none-in-dragleave-crash-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsinputimagescrolledxyexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/input-image-scrolled-x-y-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsinputTextneverfiredonkeydowncancelexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/inputText-never-fired-on-keydown-cancel-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventskeyeventsininputbuttonexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/key-events-in-input-button-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventskeyeventsininputtextexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/key-events-in-input-text-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventskeydown1expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-1-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventskeydownleftrightkeysexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-leftright-keys-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventskeydownnumpadkeysexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-numpad-keys-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventskeyeventiframeremovedcrashexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/keyevent-iframe-removed-crash-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventskeypressfocuschangeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/keypress-focus-change-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventskeypressinserttabexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/keypress-insert-tab-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmouseclickeventsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-click-events-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmousecursorchangeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-change-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmousecursorexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmousecursorimagesetexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-image-set-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmousecursormultiframecurexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-multiframecur-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmousecursornomousemoveexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-no-mousemove-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmousedragfromframeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-drag-from-frame-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmousedragfromframetootherframeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-drag-from-frame-to-other-frame-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmousedowninsubframescrollbarexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mousedown-in-subframe-scrollbar-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmousedowninsidedragstartshouldnotcausecrashexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mousedown-inside-dragstart-should-not-cause-crash-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmousemoveafterdragoverscrollbarexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mousemove-after-drag-over-scrollbar-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmouseoutonwindowexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouseout-on-window-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmouseoverbuttonexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouseover-button-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmouseovermouseout2expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouseover-mouseout2-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmouseupfrombutton2expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/mouseup-from-button2-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmovingtextshouldfiredropanddragendevents2expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/moving-text-should-fire-drop-and-dragend-events-2-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmovingtextshouldfiredropanddragendeventsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/moving-text-should-fire-drop-and-dragend-events-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsmultilinelinkarrownavigationexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/multiline-link-arrow-navigation-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsnobluronpageleaveexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/no-blur-on-page-leave-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsnoscrolloninputtextselectionexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/no-scroll-on-input-text-selection-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsnodeeventanchorlockexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/node-event-anchor-lock-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsoffsetXoffsetYexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/offsetX-offsetY-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsonchangerangesliderexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-range-slider-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsonchangesetvalueexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-setvalue-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsonchangetextformfieldexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-text-form-field-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsondragenterexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/ondragenter-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsondroptexthtmlexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/ondrop-text-html-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsonloadreentryexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/onload-re-entry-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsonlyvaliddroptargetsreceivefiledropexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/only-valid-drop-targets-receive-file-drop-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsoverflowscrollfakemousemoveexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/overflow-scroll-fake-mouse-move-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventspagescaledmouseclickexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/page-scaled-mouse-click-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventspagescaledmouseclickiframeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/page-scaled-mouse-click-iframe-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventinscrollingdivexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-in-scrolling-div-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxinnonscrollingdivexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-non-scrolling-div-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxinnonscrollingpageexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-non-scrolling-page-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxinscrollingdivexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-scrolling-div-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxinscrollingpageexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-scrolling-page-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxyinscrollingdivexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-xy-in-scrolling-div-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxyinscrollingpageexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-xy-in-scrolling-page-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingyinnonscrollingdivexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-non-scrolling-div-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingyinnonscrollingpageexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-non-scrolling-page-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingyinscrollingdivexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-scrolling-div-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingyinscrollingpageexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-scrolling-page-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventspointerevents2expectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/pointer-events-2-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventspreventdragtonavigateexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/prevent-drag-to-navigate-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsrecordedkeydowneventexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/recorded-keydown-event-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsremovechildonscrollexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/remove-child-onscroll-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsremovetargetwithshadowindragexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/remove-target-with-shadow-in-drag-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsresizeeventsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/resize-events-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsresizesubframeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/resize-subframe-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsreveallinkwhenfocusedexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/reveal-link-when-focused-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsrightclickfocusexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/right-click-focus-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsscaleandscrollbodyexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-body-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsscaleandscrolliframebodyexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-iframe-body-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsscaleandscrolliframewindowexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-iframe-window-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsscaleandscrollwindowexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-window-expected.txt</a></li>
<li>trunk/LayoutTests/platform/ios-simulator/fast/events/scoped/</li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsscopededitingcommandsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/scoped/editing-commands-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsscrollafterclickontabindexexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/scroll-after-click-on-tab-index-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsscrollinscaledpagewithoverflowhiddenexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/scroll-in-scaled-page-with-overflow-hidden-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsscrollbardoubleclickexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/scrollbar-double-click-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsselectelementexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/select-element-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsselectionchangeuserinitiatedexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/selectionchange-user-initiated-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsselectstartbyarrowkeysexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-arrow-keys-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsselectstartbyarrowkeyspreventdefaultexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-arrow-keys-prevent-default-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsselectstartbydoubletripleclicksexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-double-triple-clicks-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsselectstartbydragexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-drag-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsselectstartbysingleclickwithshiftexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-single-click-with-shift-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsselectstartpreventselectallexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-prevent-selectall-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsselectstartpreventselectiononrightclickexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-prevent-selection-on-right-click-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsshadoweventpathexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/shadow-event-path-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsshowmodaldialogonbluronfocusexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/show-modal-dialog-onblur-onfocus-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsspecialkeyeventsininputtextexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/special-key-events-in-input-text-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsstandaloneimagedragtoeditableexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/standalone-image-drag-to-editable-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstabfocuslinkincanvasexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/tab-focus-link-in-canvas-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstabindexfocusblurallexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/tabindex-focus-blur-all-expected.txt</a></li>
<li>trunk/LayoutTests/platform/ios-simulator/fast/events/touch/</li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchbasicmultitoucheventsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-multi-touch-events-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchbasicmultitoucheventslimitedexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-multi-touch-events-limited-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchbasicsingletoucheventsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-single-touch-events-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchdocumentcreatetouchexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/document-create-touch-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchdocumentcreatetouchlistexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/document-create-touch-list-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchemulatetoucheventsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/emulate-touch-events-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchemulatedtouchiframeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/emulated-touch-iframe-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchframehoverupdateexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/frame-hover-update-expected.txt</a></li>
<li>trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/</li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturecontextmenuonlongpressexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-long-press-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturecontextmenuonlongtapexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-long-tap-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturecontextmenuontwofingertapexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-two-finger-tap-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturegestureclickexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-click-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturegesturedblclickexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-dblclick-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturegesturescrollexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-scroll-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturegesturescrollbarexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-scrollbar-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturegesturetapactivestateiframeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-tap-active-state-iframe-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturelongpressondraggableelementiniframetriggersdragexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-in-iframe-triggers-drag-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturelongpressondraggableelementinnestediframestriggersdragexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-in-nested-iframes-triggers-drag-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturelongpressondraggableelementtriggersdragexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-triggers-drag-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturepadgesturecancelexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/pad-gesture-cancel-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturerightclickgesturessetcursoratcorrectpositionexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/right-click-gestures-set-cursor-at-correct-position-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrolldivnotpropagatedexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-not-propagated-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrolldivpropagatedexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-propagated-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrolldivtwicepropagatedexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-twice-propagated-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrolliframeeditableexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-iframe-editable-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrollpagenotpropagatedexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-page-not-propagated-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrollpagepropagatedexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-page-propagated-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrollsidewaysexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-sideways-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchmultitouchgroupedtargetsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-grouped-targets-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchmultitouchinsideiframesexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-inside-iframes-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchmultitouchinsidenestediframesexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-inside-nested-iframes-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchpagescaledtouchgestureclickexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/page-scaled-touch-gesture-click-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchtouchbeforepressingspinbuttonexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-before-pressing-spin-button-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchtouchcoordsinzoomandscrollexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-coords-in-zoom-and-scroll-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchtouchinputelementchangedocumentsexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-input-element-change-documents-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchtouchinsideiframescrolledexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-inside-iframe-scrolled-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchtouchscaledscrolledexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-scaled-scrolled-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchtouchsliderexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-slider-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventstouchtouchslidernojstouchlistenerexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-slider-no-js-touch-listener-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventsupdateLayoutForHitTestexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/updateLayoutForHitTest-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventswheeleventbasicexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-basic-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventswheeleventdirectioninvertedfromdeviceexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-direction-inverted-from-device-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventswheeleventinhorizontalscrollbarinrtlexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-horizontal-scrollbar-in-rtl-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventswheeleventintextnodeexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-text-node-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventswheeleventinverticalscrollbarinrtlexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-vertical-scrollbar-in-rtl-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventswheeleventmousewheelinteractionexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-mousewheel-interaction-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventswillrevealedgesbodyattributesexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-body-attributes-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventswillrevealedgeseventlistenersexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-event-listeners-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventswillrevealedgeswindowattributesexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-window-attributes-expected.txt</a></li>
<li><a href="#trunkLayoutTestsplatformiossimulatorfasteventszoomdblclickexpectedtxt">trunk/LayoutTests/platform/ios-simulator/fast/events/zoom-dblclick-expected.txt</a></li>
</ul>
</div>
<div id="patch">
<h3>Diff</h3>
<a id="trunkLayoutTestsChangeLog"></a>
<div class="modfile"><h4>Modified: trunk/LayoutTests/ChangeLog (174617 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/ChangeLog 2014-10-10 23:04:18 UTC (rev 174617)
+++ trunk/LayoutTests/ChangeLog 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -1,5 +1,11 @@
</span><span class="cx"> 2014-10-10 Simon Fraser <simon.fraser@apple.com>
</span><span class="cx">
</span><ins>+ iOS Simulator results for fast/events tests.
+
+ * platform/ios-simulator/fast/events/*: Added
+
+2014-10-10 Simon Fraser <simon.fraser@apple.com>
+
</ins><span class="cx"> iOS Simulator results for fast/dynamic tests.
</span><span class="cx">
</span><span class="cx"> * platform/ios-simulator/fast/dynamic/*: Added
</span></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfastencodingdenormalisedvoicedjapanesecharsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/encoding/denormalised-voiced-japanese-chars-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/encoding/denormalised-voiced-japanese-chars-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/encoding/denormalised-voiced-japanese-chars-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,22 @@
</span><ins>+layer at (0,0) size 800x600
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x264
+ RenderBlock {HTML} at (0,0) size 800x264
+ RenderBody {BODY} at (8,8) size 784x240
+ RenderBlock (anonymous) at (0,0) size 784x60
+ RenderText {#text} at (0,0) size 766x59
+ text run at (0,0) width 766: "This test checks that the decomposed unicode version of voiced japanese hiragana and katakana characters are rendered"
+ text run at (0,20) width 763: "the same as the precomposed version. This test is a pixel-test, and passes when the text in the two heading elements are"
+ text run at (0,40) width 60: "identical."
+ RenderBlock {H2} at (0,79) size 784x31
+ RenderText {#text} at (0,1) size 168x28
+ text run at (0,1) width 168: "\x{30CF}\x{3099}\x{30CA}\x{30CA}\x{3068}\x{30CF}\x{309A}\x{30CA}\x{30DE}"
+ RenderBlock {P} at (0,129) size 784x21
+ RenderText {#text} at (0,0) size 166x19
+ text run at (0,0) width 166: "The above is decomposed"
+ RenderBlock {H2} at (0,169) size 784x31
+ RenderText {#text} at (0,1) size 168x28
+ text run at (0,1) width 168: "\x{30D0}\x{30CA}\x{30CA}\x{3068}\x{30D1}\x{30CA}\x{30DE}"
+ RenderBlock {P} at (0,219) size 784x21
+ RenderText {#text} at (0,0) size 172x19
+ text run at (0,0) width 172: "The above is precomposed"
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfastencodinginvalidUTF8expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/encoding/invalid-UTF-8-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/encoding/invalid-UTF-8-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/encoding/invalid-UTF-8-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,15 @@
</span><ins>+layer at (0,0) size 800x600
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x600
+ RenderBlock {HTML} at (0,0) size 800x600
+ RenderBody {BODY} at (8,8) size 784x576
+ RenderBlock {P} at (0,0) size 784x20
+ RenderText {#text} at (0,0) size 336x19
+ text run at (0,0) width 336: "This tests the rendering of invalid UTF-8 sequences."
+ RenderBlock {P} at (0,36) size 784x20
+ RenderText {#text} at (0,0) size 511x19
+ text run at (0,0) width 511: "The output should be: \"\x{442}??\x{442}\" (with black diamonds in place of question marks)."
+ RenderBlock {HR} at (0,72) size 784x2 [border: (1px inset #000000)]
+ RenderBlock {P} at (0,90) size 784x20
+ RenderText {#text} at (0,0) size 39x19
+ text run at (0,0) width 39: "\x{442}\x{FFFD}\x{FFFD}\x{442}"
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfastencodingutf16bigendianexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/encoding/utf-16-big-endian-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/encoding/utf-16-big-endian-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/encoding/utf-16-big-endian-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,498 @@
</span><ins>+layer at (0,0) size 807x1202
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x1202
+ RenderBlock {HTML} at (0,0) size 800x1203
+ RenderBody {BODY} at (8,8) size 784x1182 [bgcolor=#EEEEEE]
+ RenderBlock (anonymous) at (0,0) size 784x22
+ RenderInline {SPAN} at (0,0) size 192x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 192x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderTable {TABLE} at (0,0) size 192x22
+ RenderTableSection {TBODY} at (0,0) size 192x22
+ RenderTableRow {TR} at (0,0) size 192x22
+ RenderTableCell {TD} at (0,0) size 116x22 [r=0 c=0 rs=1 cs=1]
+ RenderText {#text} at (1,1) size 114x19
+ text run at (1,1) width 114: "Record Locator:"
+ RenderTableCell {TD} at (116,0) size 76x22 [r=0 c=1 rs=1 cs=1]
+ RenderInline {B} at (0,0) size 74x19
+ RenderText {#text} at (1,1) size 74x19
+ text run at (1,1) width 74: "WHGNSO"
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,28) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,37) size 784x48
+ RenderInline {SPAN} at (0,0) size 114x42
+ RenderInline {SPAN} at (0,0) size 114x42
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 114x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,0) size 57x23
+ RenderText {#text} at (57,1) size 57x19
+ text run at (57,1) width 5: " "
+ text run at (61,1) width 53: "Names"
+ RenderBR {BR} at (113,16) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 104x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,90) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,99) size 784x71
+ RenderInline {SPAN} at (0,0) size 586x66
+ RenderInline {SPAN} at (0,0) size 586x66
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,2) size 66x20
+ RenderText {#text} at (66,3) size 4x15
+ text run at (66,3) width 4: " "
+ RenderInline {SPAN} at (0,0) size 83x19
+ RenderText {#text} at (69,0) size 83x19
+ text run at (69,0) width 83: "Addresses"
+ RenderBR {BR} at (151,15) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,176) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,184) size 784x44
+ RenderInline {SPAN} at (0,0) size 129x42
+ RenderInline {SPAN} at (0,0) size 129x42
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 129x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,0) size 62x23
+ RenderText {#text} at (62,1) size 67x19
+ text run at (62,1) width 5: " "
+ text run at (66,1) width 63: "Phones "
+ RenderBR {BR} at (128,16) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,291) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,298) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,307) size 784x24
+ RenderInline {SPAN} at (0,0) size 136x15
+ RenderInline {SPAN} at (0,0) size 136x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 136x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,0) size 68x23
+ RenderText {#text} at (68,1) size 68x19
+ text run at (68,1) width 5: " "
+ text run at (72,1) width 64: "Itinerary"
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,330) size 784x67
+ RenderTable {TABLE} at (0,0) size 584x66
+ RenderTableSection {TBODY} at (0,0) size 584x66
+ RenderTableRow {TR} at (0,2) size 584x62
+ RenderTableCell {TD} at (2,32) size 2x2 [r=0 c=0 rs=1 cs=1]
+ RenderTableCell {TD} at (6,2) size 2x2 [r=0 c=1 rs=1 cs=1]
+ RenderTableCell {TD} at (10,20) size 151x25 [r=0 c=2 rs=1 cs=1]
+ RenderImage {IMG} at (1,1) size 149x23
+ RenderText {#text} at (0,0) size 0x0
+ RenderTableCell {TD} at (163,2) size 419x62 [r=0 c=3 rs=1 cs=1]
+ RenderText {#text} at (1,1) size 145x19
+ text run at (1,1) width 145: "TUR - Tour Package"
+ RenderBR {BR} at (145,16) size 1x0
+ RenderText {#text} at (1,21) size 229x19
+ text run at (1,21) width 229: "Date: Sunday, January 12, 2003"
+ RenderBR {BR} at (229,36) size 1x0
+ RenderText {#text} at (1,41) size 417x19
+ text run at (1,41) width 417: "Comments: -** TICKETLESS CONF CODE IS WHGNSO**"
+ RenderBlock (anonymous) at (0,396) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,402) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,411) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,411) size 784x217
+ RenderTable {TABLE} at (0,0) size 719x216
+ RenderTableSection {TBODY} at (0,0) size 719x216
+ RenderTableRow {TR} at (0,2) size 719x212
+ RenderTableCell {TD} at (2,107) size 2x2 [r=0 c=0 rs=1 cs=1]
+ RenderTableCell {TD} at (6,2) size 2x2 [r=0 c=1 rs=1 cs=1]
+ RenderTableCell {TD} at (10,95) size 95x25 [r=0 c=2 rs=1 cs=1]
+ RenderImage {IMG} at (1,1) size 93x23
+ RenderText {#text} at (0,0) size 0x0
+ RenderTableCell {TD} at (107,2) size 610x212 [r=0 c=3 rs=1 cs=1]
+ RenderBlock (anonymous) at (1,1) size 608x140
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "Air "
+ RenderBR {BR} at (0,0) size 0x0
+ RenderText {#text} at (0,20) size 485x19
+ text run at (0,20) width 51: "United "
+ text run at (50,20) width 84: "Flight 1187 "
+ text run at (133,20) width 123: "Booking Code:M "
+ text run at (255,20) width 230: "Date: Sunday, January 12, 2003"
+ RenderBR {BR} at (484,35) size 1x0
+ RenderText {#text} at (0,40) size 391x19
+ text run at (0,40) width 391: "From: San Francisco Intl Arpt, San Francisco CA - U.S."
+ RenderBR {BR} at (390,55) size 1x0
+ RenderText {#text} at (0,60) size 404x19
+ text run at (0,60) width 26: "To: "
+ text run at (25,60) width 379: "Burbank Glendale Pasadena Arpt, Burbank CA - U.S."
+ RenderBR {BR} at (403,75) size 1x0
+ RenderText {#text} at (0,80) size 248x19
+ text run at (0,80) width 129: "Departs: 6:05 PM "
+ text run at (128,80) width 120: "Arrives: 7:10 PM"
+ RenderBR {BR} at (247,95) size 1x0
+ RenderText {#text} at (0,100) size 50x19
+ text run at (0,100) width 50: "Status:"
+ RenderInline {SPACE} at (0,0) size 129x39
+ RenderText {#text} at (49,100) size 76x19
+ text run at (49,100) width 76: " confirmed"
+ RenderInline {SPACE} at (0,0) size 129x39
+ RenderText {#text} at (124,100) size 5x19
+ text run at (124,100) width 5: " "
+ RenderBR {BR} at (0,0) size 0x0
+ RenderText {#text} at (0,120) size 46x19
+ text run at (0,120) width 46: "Seats:"
+ RenderBR {BR} at (45,135) size 1x0
+ RenderBlock (anonymous) at (1,141) size 608x50
+ RenderTable {TABLE} at (0,0) size 608x50 [border: (1px outset #808080)]
+ RenderTableSection {TBODY} at (1,1) size 606x48
+ RenderTableRow {TR} at (0,0) size 606x24 [bgcolor=#E0E0E0]
+ RenderTableCell {TD} at (0,0) size 98x24 [border: (1px inset #808080)] [r=0 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 43x19
+ text run at (2,2) width 43: "Name"
+ RenderTableCell {TD} at (98,0) size 37x24 [border: (1px inset #808080)] [r=0 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 33x19
+ text run at (2,2) width 33: "Seat"
+ RenderTableCell {TD} at (135,0) size 79x24 [border: (1px inset #808080)] [r=0 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 46x19
+ text run at (2,2) width 46: "Status"
+ RenderTableCell {TD} at (214,0) size 318x24 [border: (1px inset #808080)] [r=0 c=3 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 35x19
+ text run at (2,2) width 35: "Type"
+ RenderTableCell {TD} at (532,0) size 74x24 [border: (1px inset #808080)] [r=0 c=4 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 70x19
+ text run at (2,2) width 70: "Comment"
+ RenderTableRow {TR} at (0,24) size 606x24
+ RenderTableCell {TD} at (0,24) size 98x24 [border: (1px inset #808080)] [r=1 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 94x19
+ text run at (2,2) width 94: "HAO,SCOTT"
+ RenderTableCell {TD} at (98,24) size 37x24 [border: (1px inset #808080)] [r=1 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 29x19
+ text run at (2,2) width 29: "08A"
+ RenderTableCell {TD} at (135,24) size 79x24 [border: (1px inset #808080)] [r=1 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 75x19
+ text run at (2,2) width 75: "confirmed "
+ RenderTableCell {TD} at (214,24) size 318x24 [border: (1px inset #808080)] [r=1 c=3 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 314x19
+ text run at (2,2) width 314: "Non-Smoking, Window Seat, Preferred Seat"
+ RenderTableCell {TD} at (532,24) size 74x24 [border: (1px inset #808080)] [r=1 c=4 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 5x19
+ text run at (2,2) width 5: " "
+ RenderBlock (anonymous) at (1,191) size 608x20
+ RenderInline {SPACE} at (0,0) size 0x19
+ RenderInline {SPACE} at (0,0) size 0x19
+ RenderBR {BR} at (0,0) size 0x19
+ RenderBlock (anonymous) at (0,627) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,634) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,642) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,642) size 784x217
+ RenderTable {TABLE} at (0,0) size 606x216
+ RenderTableSection {TBODY} at (0,0) size 606x216
+ RenderTableRow {TR} at (0,2) size 606x212
+ RenderTableCell {TD} at (2,107) size 2x2 [r=0 c=0 rs=1 cs=1]
+ RenderTableCell {TD} at (6,2) size 2x2 [r=0 c=1 rs=1 cs=1]
+ RenderTableCell {TD} at (10,95) size 95x25 [r=0 c=2 rs=1 cs=1]
+ RenderImage {IMG} at (1,1) size 93x23
+ RenderText {#text} at (0,0) size 0x0
+ RenderTableCell {TD} at (107,2) size 497x212 [r=0 c=3 rs=1 cs=1]
+ RenderBlock (anonymous) at (1,1) size 495x140
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "Air "
+ RenderBR {BR} at (0,0) size 0x0
+ RenderText {#text} at (0,20) size 466x19
+ text run at (0,20) width 51: "United "
+ text run at (50,20) width 76: "Flight 480 "
+ text run at (125,20) width 123: "Booking Code:Q "
+ text run at (247,20) width 219: "Date: Friday, January 24, 2003"
+ RenderBR {BR} at (465,35) size 1x0
+ RenderText {#text} at (0,40) size 425x19
+ text run at (0,40) width 425: "From: Burbank Glendale Pasadena Arpt, Burbank CA - U.S."
+ RenderBR {BR} at (424,55) size 1x0
+ RenderText {#text} at (0,60) size 370x19
+ text run at (0,60) width 26: "To: "
+ text run at (25,60) width 345: "San Francisco Intl Arpt, San Francisco CA - U.S."
+ RenderBR {BR} at (369,75) size 1x0
+ RenderText {#text} at (0,80) size 248x19
+ text run at (0,80) width 129: "Departs: 1:40 PM "
+ text run at (128,80) width 120: "Arrives: 2:50 PM"
+ RenderBR {BR} at (247,95) size 1x0
+ RenderText {#text} at (0,100) size 50x19
+ text run at (0,100) width 50: "Status:"
+ RenderInline {SPACE} at (0,0) size 129x39
+ RenderText {#text} at (49,100) size 76x19
+ text run at (49,100) width 76: " confirmed"
+ RenderInline {SPACE} at (0,0) size 129x39
+ RenderText {#text} at (124,100) size 5x19
+ text run at (124,100) width 5: " "
+ RenderBR {BR} at (0,0) size 0x0
+ RenderText {#text} at (0,120) size 46x19
+ text run at (0,120) width 46: "Seats:"
+ RenderBR {BR} at (45,135) size 1x0
+ RenderBlock (anonymous) at (1,141) size 495x50
+ RenderTable {TABLE} at (0,0) size 495x50 [border: (1px outset #808080)]
+ RenderTableSection {TBODY} at (1,1) size 493x48
+ RenderTableRow {TR} at (0,0) size 493x24 [bgcolor=#E0E0E0]
+ RenderTableCell {TD} at (0,0) size 98x24 [border: (1px inset #808080)] [r=0 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 43x19
+ text run at (2,2) width 43: "Name"
+ RenderTableCell {TD} at (98,0) size 37x24 [border: (1px inset #808080)] [r=0 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 33x19
+ text run at (2,2) width 33: "Seat"
+ RenderTableCell {TD} at (135,0) size 79x24 [border: (1px inset #808080)] [r=0 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 46x19
+ text run at (2,2) width 46: "Status"
+ RenderTableCell {TD} at (214,0) size 205x24 [border: (1px inset #808080)] [r=0 c=3 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 35x19
+ text run at (2,2) width 35: "Type"
+ RenderTableCell {TD} at (419,0) size 74x24 [border: (1px inset #808080)] [r=0 c=4 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 70x19
+ text run at (2,2) width 70: "Comment"
+ RenderTableRow {TR} at (0,24) size 493x24
+ RenderTableCell {TD} at (0,24) size 98x24 [border: (1px inset #808080)] [r=1 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 94x19
+ text run at (2,2) width 94: "HAO,SCOTT"
+ RenderTableCell {TD} at (98,24) size 37x24 [border: (1px inset #808080)] [r=1 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 28x19
+ text run at (2,2) width 28: "13F"
+ RenderTableCell {TD} at (135,24) size 79x24 [border: (1px inset #808080)] [r=1 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 75x19
+ text run at (2,2) width 75: "confirmed "
+ RenderTableCell {TD} at (214,24) size 205x24 [border: (1px inset #808080)] [r=1 c=3 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 201x19
+ text run at (2,2) width 201: "Non-Smoking, Window Seat"
+ RenderTableCell {TD} at (419,24) size 74x24 [border: (1px inset #808080)] [r=1 c=4 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 5x19
+ text run at (2,2) width 5: " "
+ RenderBlock (anonymous) at (1,191) size 495x20
+ RenderInline {SPACE} at (0,0) size 0x19
+ RenderInline {SPACE} at (0,0) size 0x19
+ RenderBR {BR} at (0,0) size 0x19
+ RenderBlock (anonymous) at (0,858) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,865) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,874) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,874) size 784x127
+ RenderTable {TABLE} at (0,0) size 618x126
+ RenderTableSection {TBODY} at (0,0) size 618x126
+ RenderTableRow {TR} at (0,2) size 618x122
+ RenderTableCell {TD} at (2,62) size 2x2 [r=0 c=0 rs=1 cs=1]
+ RenderTableCell {TD} at (6,2) size 2x2 [r=0 c=1 rs=1 cs=1]
+ RenderTableCell {TD} at (10,50) size 95x25 [r=0 c=2 rs=1 cs=1]
+ RenderImage {IMG} at (1,1) size 93x23
+ RenderText {#text} at (0,0) size 0x0
+ RenderTableCell {TD} at (107,2) size 509x122 [r=0 c=3 rs=1 cs=1]
+ RenderText {#text} at (1,1) size 24x19
+ text run at (1,1) width 24: "Air "
+ RenderBR {BR} at (0,0) size 0x0
+ RenderText {#text} at (1,21) size 506x19
+ text run at (1,21) width 89: "UNKNOWN "
+ text run at (89,21) width 76: "Flight 123 "
+ text run at (164,21) width 121: "Booking Code:Y "
+ text run at (284,21) width 223: "Date: Tuesday, March 25, 2003"
+ RenderBR {BR} at (506,36) size 1x0
+ RenderText {#text} at (1,41) size 391x19
+ text run at (1,41) width 391: "From: San Francisco Intl Arpt, San Francisco CA - U.S."
+ RenderBR {BR} at (391,56) size 1x0
+ RenderText {#text} at (1,61) size 370x19
+ text run at (1,61) width 26: "To: "
+ text run at (26,61) width 345: "San Francisco Intl Arpt, San Francisco CA - U.S."
+ RenderBR {BR} at (370,76) size 1x0
+ RenderText {#text} at (1,81) size 173x19
+ text run at (1,81) width 92: "Departs: n/a "
+ text run at (92,81) width 82: "Arrives: n/a"
+ RenderBR {BR} at (173,96) size 1x0
+ RenderText {#text} at (1,101) size 50x19
+ text run at (1,101) width 50: "Status:"
+ RenderInline {SPACE} at (0,0) size 198x19
+ RenderText {#text} at (50,101) size 193x19
+ text run at (50,101) width 193: " requested, await response"
+ RenderInline {SPACE} at (0,0) size 6x19
+ RenderText {#text} at (242,101) size 6x19
+ text run at (242,101) width 6: " "
+ RenderBR {BR} at (247,116) size 1x0
+ RenderBlock (anonymous) at (0,1000) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,1006) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,1015) size 784x54
+ RenderInline {SPAN} at (0,0) size 196x49
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 98x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,1) size 20x20
+ RenderText {#text} at (20,0) size 78x19
+ text run at (20,0) width 5: " "
+ text run at (24,0) width 74: "Remarks:"
+ RenderBR {BR} at (97,15) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBR {BR} at (0,21) size 0x15
+ RenderInline {SPAN} at (0,0) size 196x15
+ RenderText {#text} at (0,37) size 196x15
+ text run at (0,37) width 124: "SERVICE FEE MCO "
+ text run at (123,37) width 73: "8103220490"
+ RenderBR {BR} at (195,49) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,1075) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,1083) size 784x24
+ RenderInline {SPAN} at (0,0) size 188x15
+ RenderInline {SPAN} at (0,0) size 188x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,0) size 68x23
+ RenderText {#text} at (68,1) size 5x19
+ text run at (68,1) width 5: " "
+ RenderInline {B} at (0,0) size 112x19
+ RenderText {#text} at (72,1) size 112x19
+ text run at (72,1) width 112: "Web Bookings"
+ RenderText {#text} at (183,1) size 5x19
+ text run at (183,1) width 5: " "
+ RenderInline {SPAN} at (0,0) size 1x19
+ RenderBR {BR} at (187,16) size 1x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,1113) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,1122) size 784x22
+ RenderInline {SPAN} at (0,0) size 279x15
+ RenderInline {SPAN} at (0,0) size 279x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 279x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,1) size 20x20
+ RenderText {#text} at (20,0) size 259x19
+ text run at (20,0) width 5: " "
+ text run at (24,0) width 255: "Remarks and Service Information"
+ RenderBR {BR} at (278,15) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,1149) size 784x33
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock {P} at (0,15) size 784x17
+ RenderText {#text} at (0,0) size 201x15
+ text run at (0,0) width 201: "This itinerary is subject to change. "
+ RenderInline {A} at (0,0) size 162x15 [color=#0000EE]
+ RenderText {#text} at (200,0) size 162x15
+ text run at (200,0) width 162: "Click here for latest updates"
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,1194) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+layer at (23,45) size 104x15
+ RenderInline (relative positioned) {SPAN} at (0,0) size 104x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 104x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,23) size 20x20
+ RenderText {#text} at (20,31) size 4x15
+ text run at (20,31) width 4: " "
+ RenderInline {SPAN} at (0,0) size 81x15
+ RenderText {#text} at (23,31) size 81x15
+ text run at (23,31) width 81: "HAO, SCOTT"
+ RenderBR {BR} at (103,43) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+layer at (23,108) size 586x39
+ RenderInline (relative positioned) {SPAN} at (0,0) size 586x39
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,22) size 20x20
+ RenderText {#text} at (20,30) size 566x15
+ text run at (20,30) width 4: " "
+ text run at (23,30) width 56: "Address: "
+ text run at (78,30) width 508: "ST. JUDE MEDICAL, 21700 OXNARD ST SUITE 800, WOODLAND HILLS CA Z/91367 "
+ RenderBR {BR} at (585,42) size 1x0
+ RenderImage {IMG} at (0,46) size 20x20
+ RenderText {#text} at (20,54) size 403x15
+ text run at (20,54) width 4: " "
+ text run at (23,54) width 49: "Deliver: "
+ text run at (71,54) width 102: "DEBI STANGEL, "
+ text run at (172,54) width 116: "119 GLEN COURT, "
+ text run at (287,54) width 136: "DANVILLE CA Z/94526"
+layer at (23,193) size 20x15
+ RenderInline (relative positioned) {SPAN} at (0,0) size 20x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,23) size 20x20
+ RenderText {#text} at (0,0) size 0x0
+layer at (23,236) size 784x64
+ RenderBlock (anonymous) at (0,227) size 784x65
+layer at (43,221) size 524x64
+ RenderTable {TABLE} at (0,0) size 524x64 [border: (1px outset #808080)]
+ RenderTableSection {TBODY} at (1,1) size 522x62
+ RenderTableRow {TR} at (0,2) size 522x24 [bgcolor=#E0E0E0]
+ RenderTableCell {TD} at (2,2) size 95x24 [border: (1px inset #808080)] [r=0 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 35x19
+ text run at (2,2) width 35: "Type"
+ RenderTableCell {TD} at (99,2) size 45x24 [border: (1px inset #808080)] [r=0 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 28x19
+ text run at (2,2) width 28: "City"
+ RenderTableCell {TD} at (146,2) size 374x24 [border: (1px inset #808080)] [r=0 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 47x19
+ text run at (2,2) width 47: "Phone"
+ RenderTableRow {TR} at (0,28) size 522x0
+ RenderTableRow {TR} at (0,30) size 522x24
+ RenderTableCell {TD} at (2,30) size 95x24 [border: (1px inset #808080)] [r=2 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 91x19
+ text run at (2,2) width 91: "Travel Agent"
+ RenderTableCell {TD} at (99,30) size 45x24 [border: (1px inset #808080)] [r=2 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 41x19
+ text run at (2,2) width 41: "(LAX)"
+ RenderTableCell {TD} at (146,30) size 374x24 [border: (1px inset #808080)] [r=2 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 370x19
+ text run at (2,2) width 370: "RQ0/818 990-4053-PLAZA TRAVEL - 05838276-RC"
+ RenderTableRow {TR} at (0,56) size 522x0
+ RenderTableRow {TR} at (0,58) size 522x0
+ RenderTableRow {TR} at (0,60) size 522x0
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfastencodingutf16littleendianexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/encoding/utf-16-little-endian-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/encoding/utf-16-little-endian-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/encoding/utf-16-little-endian-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,498 @@
</span><ins>+layer at (0,0) size 807x1202
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x1202
+ RenderBlock {HTML} at (0,0) size 800x1203
+ RenderBody {BODY} at (8,8) size 784x1182 [bgcolor=#EEEEEE]
+ RenderBlock (anonymous) at (0,0) size 784x22
+ RenderInline {SPAN} at (0,0) size 192x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 192x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderTable {TABLE} at (0,0) size 192x22
+ RenderTableSection {TBODY} at (0,0) size 192x22
+ RenderTableRow {TR} at (0,0) size 192x22
+ RenderTableCell {TD} at (0,0) size 116x22 [r=0 c=0 rs=1 cs=1]
+ RenderText {#text} at (1,1) size 114x19
+ text run at (1,1) width 114: "Record Locator:"
+ RenderTableCell {TD} at (116,0) size 76x22 [r=0 c=1 rs=1 cs=1]
+ RenderInline {B} at (0,0) size 74x19
+ RenderText {#text} at (1,1) size 74x19
+ text run at (1,1) width 74: "WHGNSO"
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,28) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,37) size 784x48
+ RenderInline {SPAN} at (0,0) size 114x42
+ RenderInline {SPAN} at (0,0) size 114x42
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 114x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,0) size 57x23
+ RenderText {#text} at (57,1) size 57x19
+ text run at (57,1) width 5: " "
+ text run at (61,1) width 53: "Names"
+ RenderBR {BR} at (113,16) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 104x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,90) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,99) size 784x71
+ RenderInline {SPAN} at (0,0) size 586x66
+ RenderInline {SPAN} at (0,0) size 586x66
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,2) size 66x20
+ RenderText {#text} at (66,3) size 4x15
+ text run at (66,3) width 4: " "
+ RenderInline {SPAN} at (0,0) size 83x19
+ RenderText {#text} at (69,0) size 83x19
+ text run at (69,0) width 83: "Addresses"
+ RenderBR {BR} at (151,15) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,176) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,184) size 784x44
+ RenderInline {SPAN} at (0,0) size 129x42
+ RenderInline {SPAN} at (0,0) size 129x42
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 129x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,0) size 62x23
+ RenderText {#text} at (62,1) size 67x19
+ text run at (62,1) width 5: " "
+ text run at (66,1) width 63: "Phones "
+ RenderBR {BR} at (128,16) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,291) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,298) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,307) size 784x24
+ RenderInline {SPAN} at (0,0) size 136x15
+ RenderInline {SPAN} at (0,0) size 136x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 136x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,0) size 68x23
+ RenderText {#text} at (68,1) size 68x19
+ text run at (68,1) width 5: " "
+ text run at (72,1) width 64: "Itinerary"
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,330) size 784x67
+ RenderTable {TABLE} at (0,0) size 584x66
+ RenderTableSection {TBODY} at (0,0) size 584x66
+ RenderTableRow {TR} at (0,2) size 584x62
+ RenderTableCell {TD} at (2,32) size 2x2 [r=0 c=0 rs=1 cs=1]
+ RenderTableCell {TD} at (6,2) size 2x2 [r=0 c=1 rs=1 cs=1]
+ RenderTableCell {TD} at (10,20) size 151x25 [r=0 c=2 rs=1 cs=1]
+ RenderImage {IMG} at (1,1) size 149x23
+ RenderText {#text} at (0,0) size 0x0
+ RenderTableCell {TD} at (163,2) size 419x62 [r=0 c=3 rs=1 cs=1]
+ RenderText {#text} at (1,1) size 145x19
+ text run at (1,1) width 145: "TUR - Tour Package"
+ RenderBR {BR} at (145,16) size 1x0
+ RenderText {#text} at (1,21) size 229x19
+ text run at (1,21) width 229: "Date: Sunday, January 12, 2003"
+ RenderBR {BR} at (229,36) size 1x0
+ RenderText {#text} at (1,41) size 417x19
+ text run at (1,41) width 417: "Comments: -** TICKETLESS CONF CODE IS WHGNSO**"
+ RenderBlock (anonymous) at (0,396) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,402) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,411) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,411) size 784x217
+ RenderTable {TABLE} at (0,0) size 719x216
+ RenderTableSection {TBODY} at (0,0) size 719x216
+ RenderTableRow {TR} at (0,2) size 719x212
+ RenderTableCell {TD} at (2,107) size 2x2 [r=0 c=0 rs=1 cs=1]
+ RenderTableCell {TD} at (6,2) size 2x2 [r=0 c=1 rs=1 cs=1]
+ RenderTableCell {TD} at (10,95) size 95x25 [r=0 c=2 rs=1 cs=1]
+ RenderImage {IMG} at (1,1) size 93x23
+ RenderText {#text} at (0,0) size 0x0
+ RenderTableCell {TD} at (107,2) size 610x212 [r=0 c=3 rs=1 cs=1]
+ RenderBlock (anonymous) at (1,1) size 608x140
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "Air "
+ RenderBR {BR} at (0,0) size 0x0
+ RenderText {#text} at (0,20) size 485x19
+ text run at (0,20) width 51: "United "
+ text run at (50,20) width 84: "Flight 1187 "
+ text run at (133,20) width 123: "Booking Code:M "
+ text run at (255,20) width 230: "Date: Sunday, January 12, 2003"
+ RenderBR {BR} at (484,35) size 1x0
+ RenderText {#text} at (0,40) size 391x19
+ text run at (0,40) width 391: "From: San Francisco Intl Arpt, San Francisco CA - U.S."
+ RenderBR {BR} at (390,55) size 1x0
+ RenderText {#text} at (0,60) size 404x19
+ text run at (0,60) width 26: "To: "
+ text run at (25,60) width 379: "Burbank Glendale Pasadena Arpt, Burbank CA - U.S."
+ RenderBR {BR} at (403,75) size 1x0
+ RenderText {#text} at (0,80) size 248x19
+ text run at (0,80) width 129: "Departs: 6:05 PM "
+ text run at (128,80) width 120: "Arrives: 7:10 PM"
+ RenderBR {BR} at (247,95) size 1x0
+ RenderText {#text} at (0,100) size 50x19
+ text run at (0,100) width 50: "Status:"
+ RenderInline {SPACE} at (0,0) size 129x39
+ RenderText {#text} at (49,100) size 76x19
+ text run at (49,100) width 76: " confirmed"
+ RenderInline {SPACE} at (0,0) size 129x39
+ RenderText {#text} at (124,100) size 5x19
+ text run at (124,100) width 5: " "
+ RenderBR {BR} at (0,0) size 0x0
+ RenderText {#text} at (0,120) size 46x19
+ text run at (0,120) width 46: "Seats:"
+ RenderBR {BR} at (45,135) size 1x0
+ RenderBlock (anonymous) at (1,141) size 608x50
+ RenderTable {TABLE} at (0,0) size 608x50 [border: (1px outset #808080)]
+ RenderTableSection {TBODY} at (1,1) size 606x48
+ RenderTableRow {TR} at (0,0) size 606x24 [bgcolor=#E0E0E0]
+ RenderTableCell {TD} at (0,0) size 98x24 [border: (1px inset #808080)] [r=0 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 43x19
+ text run at (2,2) width 43: "Name"
+ RenderTableCell {TD} at (98,0) size 37x24 [border: (1px inset #808080)] [r=0 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 33x19
+ text run at (2,2) width 33: "Seat"
+ RenderTableCell {TD} at (135,0) size 79x24 [border: (1px inset #808080)] [r=0 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 46x19
+ text run at (2,2) width 46: "Status"
+ RenderTableCell {TD} at (214,0) size 318x24 [border: (1px inset #808080)] [r=0 c=3 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 35x19
+ text run at (2,2) width 35: "Type"
+ RenderTableCell {TD} at (532,0) size 74x24 [border: (1px inset #808080)] [r=0 c=4 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 70x19
+ text run at (2,2) width 70: "Comment"
+ RenderTableRow {TR} at (0,24) size 606x24
+ RenderTableCell {TD} at (0,24) size 98x24 [border: (1px inset #808080)] [r=1 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 94x19
+ text run at (2,2) width 94: "HAO,SCOTT"
+ RenderTableCell {TD} at (98,24) size 37x24 [border: (1px inset #808080)] [r=1 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 29x19
+ text run at (2,2) width 29: "08A"
+ RenderTableCell {TD} at (135,24) size 79x24 [border: (1px inset #808080)] [r=1 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 75x19
+ text run at (2,2) width 75: "confirmed "
+ RenderTableCell {TD} at (214,24) size 318x24 [border: (1px inset #808080)] [r=1 c=3 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 314x19
+ text run at (2,2) width 314: "Non-Smoking, Window Seat, Preferred Seat"
+ RenderTableCell {TD} at (532,24) size 74x24 [border: (1px inset #808080)] [r=1 c=4 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 5x19
+ text run at (2,2) width 5: " "
+ RenderBlock (anonymous) at (1,191) size 608x20
+ RenderInline {SPACE} at (0,0) size 0x19
+ RenderInline {SPACE} at (0,0) size 0x19
+ RenderBR {BR} at (0,0) size 0x19
+ RenderBlock (anonymous) at (0,627) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,634) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,642) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,642) size 784x217
+ RenderTable {TABLE} at (0,0) size 606x216
+ RenderTableSection {TBODY} at (0,0) size 606x216
+ RenderTableRow {TR} at (0,2) size 606x212
+ RenderTableCell {TD} at (2,107) size 2x2 [r=0 c=0 rs=1 cs=1]
+ RenderTableCell {TD} at (6,2) size 2x2 [r=0 c=1 rs=1 cs=1]
+ RenderTableCell {TD} at (10,95) size 95x25 [r=0 c=2 rs=1 cs=1]
+ RenderImage {IMG} at (1,1) size 93x23
+ RenderText {#text} at (0,0) size 0x0
+ RenderTableCell {TD} at (107,2) size 497x212 [r=0 c=3 rs=1 cs=1]
+ RenderBlock (anonymous) at (1,1) size 495x140
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "Air "
+ RenderBR {BR} at (0,0) size 0x0
+ RenderText {#text} at (0,20) size 466x19
+ text run at (0,20) width 51: "United "
+ text run at (50,20) width 76: "Flight 480 "
+ text run at (125,20) width 123: "Booking Code:Q "
+ text run at (247,20) width 219: "Date: Friday, January 24, 2003"
+ RenderBR {BR} at (465,35) size 1x0
+ RenderText {#text} at (0,40) size 425x19
+ text run at (0,40) width 425: "From: Burbank Glendale Pasadena Arpt, Burbank CA - U.S."
+ RenderBR {BR} at (424,55) size 1x0
+ RenderText {#text} at (0,60) size 370x19
+ text run at (0,60) width 26: "To: "
+ text run at (25,60) width 345: "San Francisco Intl Arpt, San Francisco CA - U.S."
+ RenderBR {BR} at (369,75) size 1x0
+ RenderText {#text} at (0,80) size 248x19
+ text run at (0,80) width 129: "Departs: 1:40 PM "
+ text run at (128,80) width 120: "Arrives: 2:50 PM"
+ RenderBR {BR} at (247,95) size 1x0
+ RenderText {#text} at (0,100) size 50x19
+ text run at (0,100) width 50: "Status:"
+ RenderInline {SPACE} at (0,0) size 129x39
+ RenderText {#text} at (49,100) size 76x19
+ text run at (49,100) width 76: " confirmed"
+ RenderInline {SPACE} at (0,0) size 129x39
+ RenderText {#text} at (124,100) size 5x19
+ text run at (124,100) width 5: " "
+ RenderBR {BR} at (0,0) size 0x0
+ RenderText {#text} at (0,120) size 46x19
+ text run at (0,120) width 46: "Seats:"
+ RenderBR {BR} at (45,135) size 1x0
+ RenderBlock (anonymous) at (1,141) size 495x50
+ RenderTable {TABLE} at (0,0) size 495x50 [border: (1px outset #808080)]
+ RenderTableSection {TBODY} at (1,1) size 493x48
+ RenderTableRow {TR} at (0,0) size 493x24 [bgcolor=#E0E0E0]
+ RenderTableCell {TD} at (0,0) size 98x24 [border: (1px inset #808080)] [r=0 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 43x19
+ text run at (2,2) width 43: "Name"
+ RenderTableCell {TD} at (98,0) size 37x24 [border: (1px inset #808080)] [r=0 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 33x19
+ text run at (2,2) width 33: "Seat"
+ RenderTableCell {TD} at (135,0) size 79x24 [border: (1px inset #808080)] [r=0 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 46x19
+ text run at (2,2) width 46: "Status"
+ RenderTableCell {TD} at (214,0) size 205x24 [border: (1px inset #808080)] [r=0 c=3 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 35x19
+ text run at (2,2) width 35: "Type"
+ RenderTableCell {TD} at (419,0) size 74x24 [border: (1px inset #808080)] [r=0 c=4 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 70x19
+ text run at (2,2) width 70: "Comment"
+ RenderTableRow {TR} at (0,24) size 493x24
+ RenderTableCell {TD} at (0,24) size 98x24 [border: (1px inset #808080)] [r=1 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 94x19
+ text run at (2,2) width 94: "HAO,SCOTT"
+ RenderTableCell {TD} at (98,24) size 37x24 [border: (1px inset #808080)] [r=1 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 28x19
+ text run at (2,2) width 28: "13F"
+ RenderTableCell {TD} at (135,24) size 79x24 [border: (1px inset #808080)] [r=1 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 75x19
+ text run at (2,2) width 75: "confirmed "
+ RenderTableCell {TD} at (214,24) size 205x24 [border: (1px inset #808080)] [r=1 c=3 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 201x19
+ text run at (2,2) width 201: "Non-Smoking, Window Seat"
+ RenderTableCell {TD} at (419,24) size 74x24 [border: (1px inset #808080)] [r=1 c=4 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 5x19
+ text run at (2,2) width 5: " "
+ RenderBlock (anonymous) at (1,191) size 495x20
+ RenderInline {SPACE} at (0,0) size 0x19
+ RenderInline {SPACE} at (0,0) size 0x19
+ RenderBR {BR} at (0,0) size 0x19
+ RenderBlock (anonymous) at (0,858) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,865) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,874) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,874) size 784x127
+ RenderTable {TABLE} at (0,0) size 618x126
+ RenderTableSection {TBODY} at (0,0) size 618x126
+ RenderTableRow {TR} at (0,2) size 618x122
+ RenderTableCell {TD} at (2,62) size 2x2 [r=0 c=0 rs=1 cs=1]
+ RenderTableCell {TD} at (6,2) size 2x2 [r=0 c=1 rs=1 cs=1]
+ RenderTableCell {TD} at (10,50) size 95x25 [r=0 c=2 rs=1 cs=1]
+ RenderImage {IMG} at (1,1) size 93x23
+ RenderText {#text} at (0,0) size 0x0
+ RenderTableCell {TD} at (107,2) size 509x122 [r=0 c=3 rs=1 cs=1]
+ RenderText {#text} at (1,1) size 24x19
+ text run at (1,1) width 24: "Air "
+ RenderBR {BR} at (0,0) size 0x0
+ RenderText {#text} at (1,21) size 506x19
+ text run at (1,21) width 89: "UNKNOWN "
+ text run at (89,21) width 76: "Flight 123 "
+ text run at (164,21) width 121: "Booking Code:Y "
+ text run at (284,21) width 223: "Date: Tuesday, March 25, 2003"
+ RenderBR {BR} at (506,36) size 1x0
+ RenderText {#text} at (1,41) size 391x19
+ text run at (1,41) width 391: "From: San Francisco Intl Arpt, San Francisco CA - U.S."
+ RenderBR {BR} at (391,56) size 1x0
+ RenderText {#text} at (1,61) size 370x19
+ text run at (1,61) width 26: "To: "
+ text run at (26,61) width 345: "San Francisco Intl Arpt, San Francisco CA - U.S."
+ RenderBR {BR} at (370,76) size 1x0
+ RenderText {#text} at (1,81) size 173x19
+ text run at (1,81) width 92: "Departs: n/a "
+ text run at (92,81) width 82: "Arrives: n/a"
+ RenderBR {BR} at (173,96) size 1x0
+ RenderText {#text} at (1,101) size 50x19
+ text run at (1,101) width 50: "Status:"
+ RenderInline {SPACE} at (0,0) size 198x19
+ RenderText {#text} at (50,101) size 193x19
+ text run at (50,101) width 193: " requested, await response"
+ RenderInline {SPACE} at (0,0) size 6x19
+ RenderText {#text} at (242,101) size 6x19
+ text run at (242,101) width 6: " "
+ RenderBR {BR} at (247,116) size 1x0
+ RenderBlock (anonymous) at (0,1000) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,1006) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,1015) size 784x54
+ RenderInline {SPAN} at (0,0) size 196x49
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 98x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,1) size 20x20
+ RenderText {#text} at (20,0) size 78x19
+ text run at (20,0) width 5: " "
+ text run at (24,0) width 74: "Remarks:"
+ RenderBR {BR} at (97,15) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBR {BR} at (0,21) size 0x15
+ RenderInline {SPAN} at (0,0) size 196x15
+ RenderText {#text} at (0,37) size 196x15
+ text run at (0,37) width 124: "SERVICE FEE MCO "
+ text run at (123,37) width 73: "8103220490"
+ RenderBR {BR} at (195,49) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,1075) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,1083) size 784x24
+ RenderInline {SPAN} at (0,0) size 188x15
+ RenderInline {SPAN} at (0,0) size 188x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,0) size 68x23
+ RenderText {#text} at (68,1) size 5x19
+ text run at (68,1) width 5: " "
+ RenderInline {B} at (0,0) size 112x19
+ RenderText {#text} at (72,1) size 112x19
+ text run at (72,1) width 112: "Web Bookings"
+ RenderText {#text} at (183,1) size 5x19
+ text run at (183,1) width 5: " "
+ RenderInline {SPAN} at (0,0) size 1x19
+ RenderBR {BR} at (187,16) size 1x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,1113) size 784x3
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock (anonymous) at (0,1122) size 784x22
+ RenderInline {SPAN} at (0,0) size 279x15
+ RenderInline {SPAN} at (0,0) size 279x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 279x19
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,1) size 20x20
+ RenderText {#text} at (20,0) size 259x19
+ text run at (20,0) width 5: " "
+ text run at (24,0) width 255: "Remarks and Service Information"
+ RenderBR {BR} at (278,15) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,1149) size 784x33
+ RenderBlock {HR} at (0,0) size 784x2 [border: (1px inset #000000)]
+ RenderBlock {P} at (0,15) size 784x17
+ RenderText {#text} at (0,0) size 201x15
+ text run at (0,0) width 201: "This itinerary is subject to change. "
+ RenderInline {A} at (0,0) size 162x15 [color=#0000EE]
+ RenderText {#text} at (200,0) size 162x15
+ text run at (200,0) width 162: "Click here for latest updates"
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock (anonymous) at (0,1194) size 784x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+layer at (23,45) size 104x15
+ RenderInline (relative positioned) {SPAN} at (0,0) size 104x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderInline {SPAN} at (0,0) size 104x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,23) size 20x20
+ RenderText {#text} at (20,31) size 4x15
+ text run at (20,31) width 4: " "
+ RenderInline {SPAN} at (0,0) size 81x15
+ RenderText {#text} at (23,31) size 81x15
+ text run at (23,31) width 81: "HAO, SCOTT"
+ RenderBR {BR} at (103,43) size 1x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+layer at (23,108) size 586x39
+ RenderInline (relative positioned) {SPAN} at (0,0) size 586x39
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,22) size 20x20
+ RenderText {#text} at (20,30) size 566x15
+ text run at (20,30) width 4: " "
+ text run at (23,30) width 56: "Address: "
+ text run at (78,30) width 508: "ST. JUDE MEDICAL, 21700 OXNARD ST SUITE 800, WOODLAND HILLS CA Z/91367 "
+ RenderBR {BR} at (585,42) size 1x0
+ RenderImage {IMG} at (0,46) size 20x20
+ RenderText {#text} at (20,54) size 403x15
+ text run at (20,54) width 4: " "
+ text run at (23,54) width 49: "Deliver: "
+ text run at (71,54) width 102: "DEBI STANGEL, "
+ text run at (172,54) width 116: "119 GLEN COURT, "
+ text run at (287,54) width 136: "DANVILLE CA Z/94526"
+layer at (23,193) size 20x15
+ RenderInline (relative positioned) {SPAN} at (0,0) size 20x15
+ RenderText {#text} at (0,0) size 0x0
+ RenderImage {IMG} at (0,23) size 20x20
+ RenderText {#text} at (0,0) size 0x0
+layer at (23,236) size 784x64
+ RenderBlock (anonymous) at (0,227) size 784x65
+layer at (43,221) size 524x64
+ RenderTable {TABLE} at (0,0) size 524x64 [border: (1px outset #808080)]
+ RenderTableSection {TBODY} at (1,1) size 522x62
+ RenderTableRow {TR} at (0,2) size 522x24 [bgcolor=#E0E0E0]
+ RenderTableCell {TD} at (2,2) size 95x24 [border: (1px inset #808080)] [r=0 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 35x19
+ text run at (2,2) width 35: "Type"
+ RenderTableCell {TD} at (99,2) size 45x24 [border: (1px inset #808080)] [r=0 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 28x19
+ text run at (2,2) width 28: "City"
+ RenderTableCell {TD} at (146,2) size 374x24 [border: (1px inset #808080)] [r=0 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 47x19
+ text run at (2,2) width 47: "Phone"
+ RenderTableRow {TR} at (0,28) size 522x0
+ RenderTableRow {TR} at (0,30) size 522x24
+ RenderTableCell {TD} at (2,30) size 95x24 [border: (1px inset #808080)] [r=2 c=0 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 91x19
+ text run at (2,2) width 91: "Travel Agent"
+ RenderTableCell {TD} at (99,30) size 45x24 [border: (1px inset #808080)] [r=2 c=1 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 41x19
+ text run at (2,2) width 41: "(LAX)"
+ RenderTableCell {TD} at (146,30) size 374x24 [border: (1px inset #808080)] [r=2 c=2 rs=1 cs=1]
+ RenderText {#text} at (2,2) size 370x19
+ text run at (2,2) width 370: "RQ0/818 990-4053-PLAZA TRAVEL - 05838276-RC"
+ RenderTableRow {TR} at (0,56) size 522x0
+ RenderTableRow {TR} at (0,58) size 522x0
+ RenderTableRow {TR} at (0,60) size 522x0
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfastencodingxmacromanencodingtestexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/encoding/xmacroman-encoding-test-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/encoding/xmacroman-encoding-test-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/encoding/xmacroman-encoding-test-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,18 @@
</span><ins>+layer at (0,0) size 800x600
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x600
+ RenderBlock {HTML} at (0,0) size 800x600
+ RenderBody {BODY} at (8,8) size 784x584
+ RenderBlock {P} at (0,0) size 784x20
+ RenderText {#text} at (0,0) size 775x19
+ text run at (0,0) width 315: "This tests the use of xmacroman as content type. "
+ text run at (314,0) width 461: "You should not see any \"garbage\" characters if xmacroman is supported"
+ RenderBlock (anonymous) at (0,36) size 784x60
+ RenderText {#text} at (0,0) size 84x19
+ text run at (0,0) width 84: "apostrophe: \x{2019}"
+ RenderBR {BR} at (83,15) size 1x0
+ RenderText {#text} at (0,20) size 70x19
+ text run at (0,20) width 70: "ellipsis: \x{2026}"
+ RenderBR {BR} at (69,35) size 1x0
+ RenderText {#text} at (0,40) size 79x19
+ text run at (0,40) width 79: "em-dash: \x{2014}"
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfastevents5056619expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/5056619-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/5056619-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/5056619-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,20 @@
</span><ins>+EDITING DELEGATE: shouldChangeSelectedDOMRange:(null) toDOMRange:range from 3 of #text > SPAN > BODY > HTML > #document to 3 of #text > SPAN > BODY > HTML > #document affinity:NSSelectionAffinityDownstream stillSelecting:FALSE
+EDITING DELEGATE: webViewDidChangeSelection:WebViewDidChangeSelectionNotification
+This tests drag and drop into a form element that is removed in its onfocus handler. Safari shouldn't crash and the dropped content shouldn't appear anywhere because there's no editable region left over underneath the mouse when the input element is removed on drop.
+| "
+"
+| <span>
+| id="span"
+| "Dra<#selection-caret>gme"
+| <input>
+| id="input"
+| onfocus="focusHandler()"
+| type="text"
+| this.value=""
+| <shadow:root>
+| <div>
+| contenteditable="plaintext-only"
+| "
+"
+| <script>
+| "runTest();"
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsanchorimagescrolledxyexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/anchor-image-scrolled-x-y-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/anchor-image-scrolled-x-y-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/anchor-image-scrolled-x-y-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsarrownavigationexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/arrow-navigation-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/arrow-navigation-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/arrow-navigation-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+This tests that you can use arrow keys to navigate.
+
+Test Failed. Selection start: 0 Selection end: 0
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsattemptscrollwithnoscrollbarsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/attempt-scroll-with-no-scrollbars-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/attempt-scroll-with-no-scrollbars-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/attempt-scroll-with-no-scrollbars-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1 @@
</span><ins>+FAILED - window should not have been scrolled but was scrolled to 40
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsautoscrollinoverflowhiddenhtmlexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-overflow-hidden-html-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-overflow-hidden-html-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-overflow-hidden-html-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+
+FAILED: anchor clicking within non-scrollable inner frame failed.
+PASSED: the autoscroll has not happened.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsautoscrollintextareaexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-textarea-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-textarea-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-textarea-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,7 @@
</span><ins>+
+
+
+
+This tests autoscroll in text area correctly shows selection highlight. To manually test, scroll the text area down to the end. Slowly drag up your mouse starting from the line closest to the upper edge of the text area. Once the contents of the text area get scrolled a little, the selection should not jump down to the end.
+
+FAILED the selection jumped down.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsautoscrollintextfieldexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-textfield-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-textfield-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-in-textfield-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+ https://bugs.webkit.org/show_bug.cgi?id=20201
+To do the test manually you have to try triggering the autoscroll by starting the dragging from within the text field and moving to the right. If the autoscroll occurs the test has PASSED.
+FAILED the textfield should have been scrolled
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsautoscrollnonscrollableiframeinscrollabledivexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-nonscrollable-iframe-in-scrollable-div-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-nonscrollable-iframe-in-scrollable-div-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-nonscrollable-iframe-in-scrollable-div-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,6 @@
</span><ins>+
+rdar://problem/6166435 Inspector doesn't auto scroll when selecting text (20451)
+To do the test manually you have to try triggering the autoscroll by starting the dragging from within the blue iframe. If the autoscroll occurs the text has passed, if the autoscroll isn't working, the test has failed
+nb: Knowing that the iframe document has a overflow: hidden on his body but the whole iframe is embedded in scrollable div, the scrollable div have to be able to trigger the autoscroll
+Though you should be able to write some long text in the input and to trigger the autoscroll within the input.
+FAILED : the autoscroll has not worked :-(
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsautoscrollshouldnotstoponkeypressexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-should-not-stop-on-keypress-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-should-not-stop-on-keypress-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/autoscroll-should-not-stop-on-keypress-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,6 @@
</span><ins>+
+FAIL frame.contentDocument.body.scrollTop + frame.clientHeight should be 2127. Was 400.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsbackspacenavigatesbackexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/backspace-navigates-back-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/backspace-navigates-back-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/backspace-navigates-back-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+This test passes if it says PASS below.
+FAIL: expected navigation back
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsbeforeloadinputtimecrashexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/beforeload-input-time-crash-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/beforeload-input-time-crash-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/beforeload-input-time-crash-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1 @@
</span><ins>+PASS if not crashed.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsbogusdropEffecteffectAllowedexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/bogus-dropEffect-effectAllowed-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/bogus-dropEffect-effectAllowed-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/bogus-dropEffect-effectAllowed-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+This test checks that effectAllowed and dropEffect cannot be set to values that aren't defined in the spec
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventscheckdefocuseventorderwhentriggeredbymouseclickexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/check-defocus-event-order-when-triggered-by-mouse-click-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/check-defocus-event-order-when-triggered-by-mouse-click-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/check-defocus-event-order-when-triggered-by-mouse-click-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,14 @@
</span><ins>+This test checks that when a user focuses on the "first input" text field, modifies its contents, and then defocuses it by clicking on the "second input" text field that the following DOM events are fired in order: Focus, Change, Blur, Focus (on "second input"), Click (on "second input"). Note, this test must be run by Dump Render Tree.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+PASS fired event is (firstInput, focus).
+FAIL fired event is (firstInput, blur). Should be (firstInput, change).
+FAIL should have fired event (firstInput, blur). But did not.
+FAIL should have fired event (secondInput, focus). But did not.
+FAIL should have fired event (secondInput, click). But did not.
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventscheckdefocuseventorderwhentriggeredbytabexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/check-defocus-event-order-when-triggered-by-tab-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/check-defocus-event-order-when-triggered-by-tab-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/check-defocus-event-order-when-triggered-by-tab-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,13 @@
</span><ins>+This test checks that when a user focuses on the "first input" text field, modifies its contents, and then defocuses it by pressing the tab key that the following DOM events are fired in order: Focus, Change, Blur, Focus (on "second input"). Note, this test must be run by Dump Render Tree.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+PASS fired event is (firstInput, focus).
+FAIL fired event is (firstInput, blur). Should be (firstInput, change).
+FAIL fired event is (secondInput, blur). Should be (firstInput, blur).
+PASS fired event is (secondInput, focus).
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsclickcountexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/click-count-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/click-count-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/click-count-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,52 @@
</span><ins>+Click inside this div
+Clicking 1 times
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+Clicking 2 times
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+Clicking 3 times
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+Clicking 4 times
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+Clicking 5 times
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+[Mouse Down] Button: 0 Click Count: 1
+[Mouse Up] Button: 0 Click Count: 1
+[Mouse Click] Button: 0 Click Count: 1
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsclickfocusanchorexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/click-focus-anchor-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/click-focus-anchor-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/click-focus-anchor-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,11 @@
</span><ins>+This test ensures that we can click to focus an a element. Click on the element below.
+
+The expected result is platform specific. GTK, QT and EFL allows all links to be mouse focusable.
+
+Result
+
+
+a1 received focus (focusable)
+a4 received focus (focusable)
+a5 received focus (focusable)
+a5 received focus (focusable)
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsclickfocuscontrolexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/click-focus-control-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/click-focus-control-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/click-focus-control-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,9 @@
</span><ins>+This test ensures that we can click to focus an a element. Click on the element below.
+
+The expected result is platform specific. Mac doesn't allow some form controls to be mouse focusable.
+
+Result
+
+a4 received focus ()
+FAIL Some form elements didn't get focus
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsclientXYinzoomandscrollexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/clientXY-in-zoom-and-scroll-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/clientXY-in-zoom-and-scroll-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/clientXY-in-zoom-and-scroll-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,27 @@
</span><ins>+Base
+PASS event.clientX is 100
+PASS event.clientY is 100
+PASS event.pageX is 100
+PASS event.pageY is 100
+
+Just zoomed
+PASS event.clientX is 83
+PASS event.clientY is 83
+PASS event.pageX is 83
+PASS event.pageY is 83
+
+Just scrolled
+PASS event.clientX is 100
+PASS event.clientY is 100
+FAIL event.pageX should be 150. Was 100.
+FAIL event.pageY should be 150. Was 100.
+
+Zoomed and scrolled
+PASS event.clientX is 83
+PASS event.clientY is 83
+FAIL event.pageX should be 133. Was 83.
+FAIL event.pageY should be 133. Was 83.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsclipboarddataTransferItemListexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/clipboard-dataTransferItemList-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/clipboard-dataTransferItemList-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/clipboard-dataTransferItemList-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,16 @@
</span><ins>+CONSOLE MESSAGE: line 67: TypeError: undefined is not an object (evaluating 'dataTransfer.items.length')
+FAIL: Timed out waiting for notifyDone to be called
+To manually test, press your browser shortcut for copy and then for paste. Several lines that say 'PASS' should appear below.
+
+Copy handler:
+Paste handler:
+Running test with Legacy copy handler and Legacy paste handler
+FAIL: 4(of type number) !== 10(of type number)
+FAIL: types array did not contain "text/html"
+FAIL: types array did not contain "custom-data"
+FAIL: sample(of type string) !== (of type string)
+FAIL: http://www.google.com/(of type string) !== (of type string)
+FAIL: <em>Markup</em>(of type string) !== (of type string)
+FAIL: hello world(of type string) !== (of type string)
+Running test with Legacy copy handler and DataTransferItemList paste handler
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsconstructorsmediastreameventconstructorexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/media-stream-event-constructor-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/media-stream-event-constructor-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/media-stream-event-constructor-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+CONSOLE MESSAGE: line 12: ReferenceError: Can't find variable: webkitMediaStream
+This tests the constructor for the MediaStreamEvent DOM class.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+FAIL successfullyParsed should be true (of type boolean). Was undefined (of type undefined).
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsconstructorsmouseeventconstructorexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/mouse-event-constructor-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/mouse-event-constructor-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/mouse-event-constructor-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,209 @@
</span><ins>+This tests the constructor for the MouseEvent DOM class.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS new MouseEvent('eventType').bubbles is false
+PASS new MouseEvent('eventType').cancelable is false
+PASS new MouseEvent('eventType').view is null
+PASS new MouseEvent('eventType').detail is 0
+PASS new MouseEvent('eventType').screenX is 0
+PASS new MouseEvent('eventType').screenY is 0
+PASS new MouseEvent('eventType').clientX is 0
+PASS new MouseEvent('eventType').clientY is 0
+PASS new MouseEvent('eventType').ctrlKey is false
+PASS new MouseEvent('eventType').shiftKey is false
+PASS new MouseEvent('eventType').altKey is false
+PASS new MouseEvent('eventType').metaKey is false
+PASS new MouseEvent('eventType').button is 0
+PASS new MouseEvent('eventType').relatedTarget is null
+PASS new MouseEvent('eventType', { bubbles: false }).bubbles is false
+PASS new MouseEvent('eventType', { bubbles: true }).bubbles is true
+PASS new MouseEvent('eventType', { cancelable: false }).cancelable is false
+PASS new MouseEvent('eventType', { cancelable: true }).cancelable is true
+PASS new MouseEvent('eventType', { view: window }).view is window
+PASS new MouseEvent('eventType', { view: this }).view is this
+PASS new MouseEvent('eventType', { view: testObject }).view is null
+PASS new MouseEvent('eventType', { view: document }).view is null
+PASS new MouseEvent('eventType', { view: undefined }).view is null
+PASS new MouseEvent('eventType', { view: null }).view is null
+PASS new MouseEvent('eventType', { view: false }).view is null
+PASS new MouseEvent('eventType', { view: true }).view is null
+PASS new MouseEvent('eventType', { view: '' }).view is null
+PASS new MouseEvent('eventType', { view: 'chocolate' }).view is null
+PASS new MouseEvent('eventType', { view: 12345 }).view is null
+PASS new MouseEvent('eventType', { view: 18446744073709551615 }).view is null
+PASS new MouseEvent('eventType', { view: NaN }).view is null
+PASS new MouseEvent('eventType', { view: {valueOf: function () { return window; } } }).view == window is false
+PASS new MouseEvent('eventType', { get view() { return 123; } }).view is null
+PASS new MouseEvent('eventType', { get view() { throw 'MouseEvent Error'; } }) threw exception MouseEvent Error.
+PASS new MouseEvent('eventType', { detail: 0 }).detail is 0
+PASS new MouseEvent('eventType', { detail: 2147483647 }).detail is 2147483647
+PASS new MouseEvent('eventType', { detail: -1 }).detail is -1
+PASS new MouseEvent('eventType', { detail: -2147483648 }).detail is -2147483648
+PASS new MouseEvent('eventType', { detail: 4294967295 }).detail is -1
+PASS new MouseEvent('eventType', { detail: 9007199254740991 }).detail is -1
+PASS new MouseEvent('eventType', { detail: 18446744073709551615 }).detail is 0
+PASS new MouseEvent('eventType', { detail: 123.45 }).detail is 123
+PASS new MouseEvent('eventType', { detail: NaN }).detail is 0
+PASS new MouseEvent('eventType', { detail: undefined }).detail is 0
+PASS new MouseEvent('eventType', { detail: null }).detail is 0
+PASS new MouseEvent('eventType', { detail: '' }).detail is 0
+PASS new MouseEvent('eventType', { detail: '12345' }).detail is 12345
+PASS new MouseEvent('eventType', { detail: '12345a' }).detail is 0
+PASS new MouseEvent('eventType', { detail: 'abc' }).detail is 0
+PASS new MouseEvent('eventType', { detail: [] }).detail is 0
+PASS new MouseEvent('eventType', { detail: [12345] }).detail is 12345
+PASS new MouseEvent('eventType', { detail: [12345, 67890] }).detail is 0
+PASS new MouseEvent('eventType', { detail: {} }).detail is 0
+PASS new MouseEvent('eventType', { detail: {moemoe: 12345} }).detail is 0
+PASS new MouseEvent('eventType', { detail: {valueOf: function () { return 12345; }} }).detail is 12345
+PASS new MouseEvent('eventType', { screenX: 0 }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: 2147483647 }).screenX is 2147483647
+PASS new MouseEvent('eventType', { screenX: -1 }).screenX is -1
+PASS new MouseEvent('eventType', { screenX: -2147483648 }).screenX is -2147483648
+PASS new MouseEvent('eventType', { screenX: 4294967295 }).screenX is -1
+PASS new MouseEvent('eventType', { screenX: 9007199254740991 }).screenX is -1
+PASS new MouseEvent('eventType', { screenX: 18446744073709551615 }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: 123.45 }).screenX is 123
+PASS new MouseEvent('eventType', { screenX: NaN }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: undefined }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: null }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: '' }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: '12345' }).screenX is 12345
+PASS new MouseEvent('eventType', { screenX: '12345a' }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: 'abc' }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: [] }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: [12345] }).screenX is 12345
+PASS new MouseEvent('eventType', { screenX: [12345, 67890] }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: {} }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: {moemoe: 12345} }).screenX is 0
+PASS new MouseEvent('eventType', { screenX: {valueOf: function () { return 12345; }} }).screenX is 12345
+PASS new MouseEvent('eventType', { screenY: 0 }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: 2147483647 }).screenY is 2147483647
+PASS new MouseEvent('eventType', { screenY: -1 }).screenY is -1
+PASS new MouseEvent('eventType', { screenY: -2147483648 }).screenY is -2147483648
+PASS new MouseEvent('eventType', { screenY: 4294967295 }).screenY is -1
+PASS new MouseEvent('eventType', { screenY: 9007199254740991 }).screenY is -1
+PASS new MouseEvent('eventType', { screenY: 18446744073709551615 }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: 123.45 }).screenY is 123
+PASS new MouseEvent('eventType', { screenY: NaN }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: undefined }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: null }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: '' }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: '12345' }).screenY is 12345
+PASS new MouseEvent('eventType', { screenY: '12345a' }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: 'abc' }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: [] }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: [12345] }).screenY is 12345
+PASS new MouseEvent('eventType', { screenY: [12345, 67890] }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: {} }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: {moemoe: 12345} }).screenY is 0
+PASS new MouseEvent('eventType', { screenY: {valueOf: function () { return 12345; }} }).screenY is 12345
+PASS new MouseEvent('eventType', { clientX: 0 }).clientX is 0
+FAIL new MouseEvent('eventType', { clientX: 2147483647 }).clientX should be 2147483647. Was 33554431.
+PASS new MouseEvent('eventType', { clientX: -1 }).clientX is -1
+FAIL new MouseEvent('eventType', { clientX: -2147483648 }).clientX should be -2147483648. Was -33554432.
+PASS new MouseEvent('eventType', { clientX: 4294967295 }).clientX is -1
+PASS new MouseEvent('eventType', { clientX: 9007199254740991 }).clientX is -1
+PASS new MouseEvent('eventType', { clientX: 18446744073709551615 }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: 123.45 }).clientX is 123
+PASS new MouseEvent('eventType', { clientX: NaN }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: undefined }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: null }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: '' }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: '12345' }).clientX is 12345
+PASS new MouseEvent('eventType', { clientX: '12345a' }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: 'abc' }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: [] }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: [12345] }).clientX is 12345
+PASS new MouseEvent('eventType', { clientX: [12345, 67890] }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: {} }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: {moemoe: 12345} }).clientX is 0
+PASS new MouseEvent('eventType', { clientX: {valueOf: function () { return 12345; }} }).clientX is 12345
+PASS new MouseEvent('eventType', { clientY: 0 }).clientY is 0
+FAIL new MouseEvent('eventType', { clientY: 2147483647 }).clientY should be 2147483647. Was 33554431.
+PASS new MouseEvent('eventType', { clientY: -1 }).clientY is -1
+FAIL new MouseEvent('eventType', { clientY: -2147483648 }).clientY should be -2147483648. Was -33554432.
+PASS new MouseEvent('eventType', { clientY: 4294967295 }).clientY is -1
+PASS new MouseEvent('eventType', { clientY: 9007199254740991 }).clientY is -1
+PASS new MouseEvent('eventType', { clientY: 18446744073709551615 }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: 123.45 }).clientY is 123
+PASS new MouseEvent('eventType', { clientY: NaN }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: undefined }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: null }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: '' }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: '12345' }).clientY is 12345
+PASS new MouseEvent('eventType', { clientY: '12345a' }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: 'abc' }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: [] }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: [12345] }).clientY is 12345
+PASS new MouseEvent('eventType', { clientY: [12345, 67890] }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: {} }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: {moemoe: 12345} }).clientY is 0
+PASS new MouseEvent('eventType', { clientY: {valueOf: function () { return 12345; }} }).clientY is 12345
+PASS new MouseEvent('eventType', { ctrlKey: false }).ctrlKey is false
+PASS new MouseEvent('eventType', { ctrlKey: true }).ctrlKey is true
+PASS new MouseEvent('eventType', { altKey: false }).altKey is false
+PASS new MouseEvent('eventType', { altKey: true }).altKey is true
+PASS new MouseEvent('eventType', { shiftKey: false }).shiftKey is false
+PASS new MouseEvent('eventType', { shiftKey: true }).shiftKey is true
+PASS new MouseEvent('eventType', { metaKey: false }).metaKey is false
+PASS new MouseEvent('eventType', { metaKey: true }).metaKey is true
+PASS new MouseEvent('eventType', { button: 0 }).button is 0
+PASS new MouseEvent('eventType', { button: 1 }).button is 1
+PASS new MouseEvent('eventType', { button: 65534 }).button is 65534
+PASS new MouseEvent('eventType', { button: 65535 }).button is 0
+PASS new MouseEvent('eventType', { button: 9007199254740991 }).button is 0
+PASS new MouseEvent('eventType', { button: -1 }).button is 0
+PASS new MouseEvent('eventType', { button: 18446744073709551615 }).button is 0
+PASS new MouseEvent('eventType', { button: 12345678901234567890 }).button is 2048
+PASS new MouseEvent('eventType', { button: 123.45 }).button is 123
+PASS new MouseEvent('eventType', { button: NaN }).button is 0
+PASS new MouseEvent('eventType', { button: undefined }).button is 0
+PASS new MouseEvent('eventType', { button: null }).button is 0
+PASS new MouseEvent('eventType', { button: '' }).button is 0
+PASS new MouseEvent('eventType', { button: '12345' }).button is 12345
+PASS new MouseEvent('eventType', { button: '12345a' }).button is 0
+PASS new MouseEvent('eventType', { button: 'abc' }).button is 0
+PASS new MouseEvent('eventType', { button: [] }).button is 0
+PASS new MouseEvent('eventType', { button: [12345] }).button is 12345
+PASS new MouseEvent('eventType', { button: [12345, 67890] }).button is 0
+PASS new MouseEvent('eventType', { button: {} }).button is 0
+PASS new MouseEvent('eventType', { button: {moemoe: 12345} }).button is 0
+PASS new MouseEvent('eventType', { button: {valueOf: function () { return 12345; }} }).button is 12345
+PASS new MouseEvent('eventType', { relatedTarget: testDiv }).relatedTarget is testDiv
+PASS new MouseEvent('eventType', { relatedTarget: document }).relatedTarget is document
+PASS new MouseEvent('eventType', { relatedTarget: xhr }).relatedTarget is xhr
+PASS new MouseEvent('eventType', { relatedTarget: window }).relatedTarget is window
+PASS new MouseEvent('eventType', { relatedTarget: testObject }).relatedTarget is null
+PASS new MouseEvent('eventType', { relatedTarget: undefined }).relatedTarget is null
+PASS new MouseEvent('eventType', { relatedTarget: null }).relatedTarget is null
+PASS new MouseEvent('eventType', { relatedTarget: false }).relatedTarget is null
+PASS new MouseEvent('eventType', { relatedTarget: true }).relatedTarget is null
+PASS new MouseEvent('eventType', { relatedTarget: '' }).relatedTarget is null
+PASS new MouseEvent('eventType', { relatedTarget: 'chocolate' }).relatedTarget is null
+PASS new MouseEvent('eventType', { relatedTarget: 12345 }).relatedTarget is null
+PASS new MouseEvent('eventType', { relatedTarget: 18446744073709551615 }).relatedTarget is null
+PASS new MouseEvent('eventType', { relatedTarget: NaN }).relatedTarget is null
+PASS new MouseEvent('eventType', { relatedTarget: {valueOf: function () { return testDiv; } } }).relatedTarget == testDiv is false
+PASS new MouseEvent('eventType', { get relatedTarget() { return 123; } }).relatedTarget is null
+PASS new MouseEvent('eventType', { get relatedTarget() { throw 'MouseEvent Error'; } }) threw exception MouseEvent Error.
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).bubbles is true
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).cancelable is true
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).view is window
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).detail is 111
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).screenX is 222
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).screenY is 333
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).clientX is 444
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).clientY is 555
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).ctrlKey is true
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).shiftKey is true
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).altKey is true
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).metaKey is true
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).button is 666
+PASS new MouseEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv }).relatedTarget is testDiv
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsconstructorswheeleventconstructorexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/wheel-event-constructor-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/wheel-event-constructor-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/constructors/wheel-event-constructor-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,281 @@
</span><ins>+This tests the constructor for the WheelEvent DOM class.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS new WheelEvent('eventType').bubbles is false
+PASS new WheelEvent('eventType').cancelable is false
+PASS new WheelEvent('eventType').view is null
+PASS new WheelEvent('eventType').detail is 0
+PASS new WheelEvent('eventType').screenX is 0
+PASS new WheelEvent('eventType').screenY is 0
+PASS new WheelEvent('eventType').clientX is 0
+PASS new WheelEvent('eventType').clientY is 0
+PASS new WheelEvent('eventType').ctrlKey is false
+PASS new WheelEvent('eventType').shiftKey is false
+PASS new WheelEvent('eventType').altKey is false
+PASS new WheelEvent('eventType').metaKey is false
+PASS new WheelEvent('eventType').button is 0
+PASS new WheelEvent('eventType').relatedTarget is null
+PASS new WheelEvent('eventType').wheelDeltaX is 0
+PASS new WheelEvent('eventType').wheelDeltaY is 0
+PASS new WheelEvent('eventType').deltaMode is WheelEvent.DOM_DELTA_PIXEL
+PASS new WheelEvent('eventType', { bubbles: false }).bubbles is false
+PASS new WheelEvent('eventType', { bubbles: true }).bubbles is true
+PASS new WheelEvent('eventType', { cancelable: false }).cancelable is false
+PASS new WheelEvent('eventType', { cancelable: true }).cancelable is true
+PASS new WheelEvent('eventType', { view: window }).view is window
+PASS new WheelEvent('eventType', { view: this }).view is this
+PASS new WheelEvent('eventType', { view: testObject }).view is null
+PASS new WheelEvent('eventType', { view: document }).view is null
+PASS new WheelEvent('eventType', { view: undefined }).view is null
+PASS new WheelEvent('eventType', { view: null }).view is null
+PASS new WheelEvent('eventType', { view: false }).view is null
+PASS new WheelEvent('eventType', { view: true }).view is null
+PASS new WheelEvent('eventType', { view: '' }).view is null
+PASS new WheelEvent('eventType', { view: 'chocolate' }).view is null
+PASS new WheelEvent('eventType', { view: 12345 }).view is null
+PASS new WheelEvent('eventType', { view: 18446744073709551615 }).view is null
+PASS new WheelEvent('eventType', { view: NaN }).view is null
+PASS new WheelEvent('eventType', { view: {valueOf: function () { return window; } } }).view == window is false
+PASS new WheelEvent('eventType', { get view() { return 123; } }).view is null
+PASS new WheelEvent('eventType', { get view() { throw 'WheelEvent Error'; } }) threw exception WheelEvent Error.
+PASS new WheelEvent('eventType', { detail: 0 }).detail is 0
+PASS new WheelEvent('eventType', { detail: 2147483647 }).detail is 2147483647
+PASS new WheelEvent('eventType', { detail: -1 }).detail is -1
+PASS new WheelEvent('eventType', { detail: -2147483648 }).detail is -2147483648
+PASS new WheelEvent('eventType', { detail: 4294967295 }).detail is -1
+PASS new WheelEvent('eventType', { detail: 9007199254740991 }).detail is -1
+PASS new WheelEvent('eventType', { detail: 18446744073709551615 }).detail is 0
+PASS new WheelEvent('eventType', { detail: 123.45 }).detail is 123
+PASS new WheelEvent('eventType', { detail: NaN }).detail is 0
+PASS new WheelEvent('eventType', { detail: undefined }).detail is 0
+PASS new WheelEvent('eventType', { detail: null }).detail is 0
+PASS new WheelEvent('eventType', { detail: '' }).detail is 0
+PASS new WheelEvent('eventType', { detail: '12345' }).detail is 12345
+PASS new WheelEvent('eventType', { detail: '12345a' }).detail is 0
+PASS new WheelEvent('eventType', { detail: 'abc' }).detail is 0
+PASS new WheelEvent('eventType', { detail: [] }).detail is 0
+PASS new WheelEvent('eventType', { detail: [12345] }).detail is 12345
+PASS new WheelEvent('eventType', { detail: [12345, 67890] }).detail is 0
+PASS new WheelEvent('eventType', { detail: {} }).detail is 0
+PASS new WheelEvent('eventType', { detail: {moemoe: 12345} }).detail is 0
+PASS new WheelEvent('eventType', { detail: {valueOf: function () { return 12345; }} }).detail is 12345
+PASS new WheelEvent('eventType', { screenX: 0 }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: 2147483647 }).screenX is 2147483647
+PASS new WheelEvent('eventType', { screenX: -1 }).screenX is -1
+PASS new WheelEvent('eventType', { screenX: -2147483648 }).screenX is -2147483648
+PASS new WheelEvent('eventType', { screenX: 4294967295 }).screenX is -1
+PASS new WheelEvent('eventType', { screenX: 9007199254740991 }).screenX is -1
+PASS new WheelEvent('eventType', { screenX: 18446744073709551615 }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: 123.45 }).screenX is 123
+PASS new WheelEvent('eventType', { screenX: NaN }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: undefined }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: null }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: '' }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: '12345' }).screenX is 12345
+PASS new WheelEvent('eventType', { screenX: '12345a' }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: 'abc' }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: [] }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: [12345] }).screenX is 12345
+PASS new WheelEvent('eventType', { screenX: [12345, 67890] }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: {} }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: {moemoe: 12345} }).screenX is 0
+PASS new WheelEvent('eventType', { screenX: {valueOf: function () { return 12345; }} }).screenX is 12345
+PASS new WheelEvent('eventType', { screenY: 0 }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: 2147483647 }).screenY is 2147483647
+PASS new WheelEvent('eventType', { screenY: -1 }).screenY is -1
+PASS new WheelEvent('eventType', { screenY: -2147483648 }).screenY is -2147483648
+PASS new WheelEvent('eventType', { screenY: 4294967295 }).screenY is -1
+PASS new WheelEvent('eventType', { screenY: 9007199254740991 }).screenY is -1
+PASS new WheelEvent('eventType', { screenY: 18446744073709551615 }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: 123.45 }).screenY is 123
+PASS new WheelEvent('eventType', { screenY: NaN }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: undefined }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: null }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: '' }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: '12345' }).screenY is 12345
+PASS new WheelEvent('eventType', { screenY: '12345a' }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: 'abc' }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: [] }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: [12345] }).screenY is 12345
+PASS new WheelEvent('eventType', { screenY: [12345, 67890] }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: {} }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: {moemoe: 12345} }).screenY is 0
+PASS new WheelEvent('eventType', { screenY: {valueOf: function () { return 12345; }} }).screenY is 12345
+PASS new WheelEvent('eventType', { clientX: 0 }).clientX is 0
+FAIL new WheelEvent('eventType', { clientX: 2147483647 }).clientX should be 2147483647. Was 33554431.
+PASS new WheelEvent('eventType', { clientX: -1 }).clientX is -1
+FAIL new WheelEvent('eventType', { clientX: -2147483648 }).clientX should be -2147483648. Was -33554432.
+PASS new WheelEvent('eventType', { clientX: 4294967295 }).clientX is -1
+PASS new WheelEvent('eventType', { clientX: 9007199254740991 }).clientX is -1
+PASS new WheelEvent('eventType', { clientX: 18446744073709551615 }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: 123.45 }).clientX is 123
+PASS new WheelEvent('eventType', { clientX: NaN }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: undefined }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: null }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: '' }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: '12345' }).clientX is 12345
+PASS new WheelEvent('eventType', { clientX: '12345a' }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: 'abc' }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: [] }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: [12345] }).clientX is 12345
+PASS new WheelEvent('eventType', { clientX: [12345, 67890] }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: {} }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: {moemoe: 12345} }).clientX is 0
+PASS new WheelEvent('eventType', { clientX: {valueOf: function () { return 12345; }} }).clientX is 12345
+PASS new WheelEvent('eventType', { clientY: 0 }).clientY is 0
+FAIL new WheelEvent('eventType', { clientY: 2147483647 }).clientY should be 2147483647. Was 33554431.
+PASS new WheelEvent('eventType', { clientY: -1 }).clientY is -1
+FAIL new WheelEvent('eventType', { clientY: -2147483648 }).clientY should be -2147483648. Was -33554432.
+PASS new WheelEvent('eventType', { clientY: 4294967295 }).clientY is -1
+PASS new WheelEvent('eventType', { clientY: 9007199254740991 }).clientY is -1
+PASS new WheelEvent('eventType', { clientY: 18446744073709551615 }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: 123.45 }).clientY is 123
+PASS new WheelEvent('eventType', { clientY: NaN }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: undefined }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: null }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: '' }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: '12345' }).clientY is 12345
+PASS new WheelEvent('eventType', { clientY: '12345a' }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: 'abc' }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: [] }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: [12345] }).clientY is 12345
+PASS new WheelEvent('eventType', { clientY: [12345, 67890] }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: {} }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: {moemoe: 12345} }).clientY is 0
+PASS new WheelEvent('eventType', { clientY: {valueOf: function () { return 12345; }} }).clientY is 12345
+PASS new WheelEvent('eventType', { wheelDeltaX: 0 }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: 2147483647 }).wheelDeltaX is 2147483647
+PASS new WheelEvent('eventType', { wheelDeltaX: -1 }).wheelDeltaX is -1
+PASS new WheelEvent('eventType', { wheelDeltaX: -2147483648 }).wheelDeltaX is -2147483648
+PASS new WheelEvent('eventType', { wheelDeltaX: 4294967295 }).wheelDeltaX is -1
+PASS new WheelEvent('eventType', { wheelDeltaX: 9007199254740991 }).wheelDeltaX is -1
+PASS new WheelEvent('eventType', { wheelDeltaX: 18446744073709551615 }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: 123.45 }).wheelDeltaX is 123
+PASS new WheelEvent('eventType', { wheelDeltaX: NaN }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: undefined }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: null }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: '' }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: '12345' }).wheelDeltaX is 12345
+PASS new WheelEvent('eventType', { wheelDeltaX: '12345a' }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: 'abc' }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: [] }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: [12345] }).wheelDeltaX is 12345
+PASS new WheelEvent('eventType', { wheelDeltaX: [12345, 67890] }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: {} }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: {moemoe: 12345} }).wheelDeltaX is 0
+PASS new WheelEvent('eventType', { wheelDeltaX: {valueOf: function () { return 12345; }} }).wheelDeltaX is 12345
+PASS new WheelEvent('eventType', { wheelDeltaY: 0 }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: 2147483647 }).wheelDeltaY is 2147483647
+PASS new WheelEvent('eventType', { wheelDeltaY: -1 }).wheelDeltaY is -1
+PASS new WheelEvent('eventType', { wheelDeltaY: -2147483648 }).wheelDeltaY is -2147483648
+PASS new WheelEvent('eventType', { wheelDeltaY: 4294967295 }).wheelDeltaY is -1
+PASS new WheelEvent('eventType', { wheelDeltaY: 9007199254740991 }).wheelDeltaY is -1
+PASS new WheelEvent('eventType', { wheelDeltaY: 18446744073709551615 }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: 123.45 }).wheelDeltaY is 123
+PASS new WheelEvent('eventType', { wheelDeltaY: NaN }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: undefined }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: null }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: '' }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: '12345' }).wheelDeltaY is 12345
+PASS new WheelEvent('eventType', { wheelDeltaY: '12345a' }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: 'abc' }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: [] }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: [12345] }).wheelDeltaY is 12345
+PASS new WheelEvent('eventType', { wheelDeltaY: [12345, 67890] }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: {} }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: {moemoe: 12345} }).wheelDeltaY is 0
+PASS new WheelEvent('eventType', { wheelDeltaY: {valueOf: function () { return 12345; }} }).wheelDeltaY is 12345
+PASS new WheelEvent('eventType', { deltaMode: 0 }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: 1 }).deltaMode is 1
+PASS new WheelEvent('eventType', { deltaMode: 4294967294 }).deltaMode is 4294967294
+PASS new WheelEvent('eventType', { deltaMode: 4294967295 }).deltaMode is 4294967295
+PASS new WheelEvent('eventType', { deltaMode: WheelEvent.DOM_DELTA_PIXEL }).deltaMode is WheelEvent.DOM_DELTA_PIXEL
+PASS new WheelEvent('eventType', { deltaMode: WheelEvent.DOM_DELTA_LINE }).deltaMode is WheelEvent.DOM_DELTA_LINE
+PASS new WheelEvent('eventType', { deltaMode: WheelEvent.DOM_DELTA_PAGE }).deltaMode is WheelEvent.DOM_DELTA_PAGE
+PASS new WheelEvent('eventType', { deltaMode: 9007199254740991 }).deltaMode is 4294967295
+PASS new WheelEvent('eventType', { deltaMode: 18446744073709551615 }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: 12345678901234567890 }).deltaMode is 3944679424
+PASS new WheelEvent('eventType', { deltaMode: -1 }).deltaMode is 4294967295
+PASS new WheelEvent('eventType', { deltaMode: 123.45 }).deltaMode is 123
+PASS new WheelEvent('eventType', { deltaMode: NaN }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: undefined }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: null }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: '' }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: '12345' }).deltaMode is 12345
+PASS new WheelEvent('eventType', { deltaMode: '12345a' }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: 'abc' }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: [] }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: [12345] }).deltaMode is 12345
+PASS new WheelEvent('eventType', { deltaMode: [12345, 67890] }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: {} }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: {moemoe: 12345} }).deltaMode is 0
+PASS new WheelEvent('eventType', { deltaMode: {valueOf: function () { return 12345; }} }).deltaMode is 12345
+PASS new WheelEvent('eventType', { ctrlKey: false }).ctrlKey is false
+PASS new WheelEvent('eventType', { ctrlKey: true }).ctrlKey is true
+PASS new WheelEvent('eventType', { altKey: false }).altKey is false
+PASS new WheelEvent('eventType', { altKey: true }).altKey is true
+PASS new WheelEvent('eventType', { shiftKey: false }).shiftKey is false
+PASS new WheelEvent('eventType', { shiftKey: true }).shiftKey is true
+PASS new WheelEvent('eventType', { metaKey: false }).metaKey is false
+PASS new WheelEvent('eventType', { metaKey: true }).metaKey is true
+PASS new WheelEvent('eventType', { button: 0 }).button is 0
+PASS new WheelEvent('eventType', { button: 1 }).button is 1
+PASS new WheelEvent('eventType', { button: 65534 }).button is 65534
+PASS new WheelEvent('eventType', { button: 65535 }).button is 0
+PASS new WheelEvent('eventType', { button: 9007199254740991 }).button is 0
+PASS new WheelEvent('eventType', { button: -1 }).button is 0
+PASS new WheelEvent('eventType', { button: 18446744073709551615 }).button is 0
+PASS new WheelEvent('eventType', { button: 12345678901234567890 }).button is 2048
+PASS new WheelEvent('eventType', { button: 123.45 }).button is 123
+PASS new WheelEvent('eventType', { button: NaN }).button is 0
+PASS new WheelEvent('eventType', { button: undefined }).button is 0
+PASS new WheelEvent('eventType', { button: null }).button is 0
+PASS new WheelEvent('eventType', { button: '' }).button is 0
+PASS new WheelEvent('eventType', { button: '12345' }).button is 12345
+PASS new WheelEvent('eventType', { button: '12345a' }).button is 0
+PASS new WheelEvent('eventType', { button: 'abc' }).button is 0
+PASS new WheelEvent('eventType', { button: [] }).button is 0
+PASS new WheelEvent('eventType', { button: [12345] }).button is 12345
+PASS new WheelEvent('eventType', { button: [12345, 67890] }).button is 0
+PASS new WheelEvent('eventType', { button: {} }).button is 0
+PASS new WheelEvent('eventType', { button: {moemoe: 12345} }).button is 0
+PASS new WheelEvent('eventType', { button: {valueOf: function () { return 12345; }} }).button is 12345
+PASS new WheelEvent('eventType', { relatedTarget: testDiv }).relatedTarget is testDiv
+PASS new WheelEvent('eventType', { relatedTarget: document }).relatedTarget is document
+PASS new WheelEvent('eventType', { relatedTarget: xhr }).relatedTarget is xhr
+PASS new WheelEvent('eventType', { relatedTarget: testObject }).relatedTarget is null
+PASS new WheelEvent('eventType', { relatedTarget: undefined }).relatedTarget is null
+PASS new WheelEvent('eventType', { relatedTarget: null }).relatedTarget is null
+PASS new WheelEvent('eventType', { relatedTarget: false }).relatedTarget is null
+PASS new WheelEvent('eventType', { relatedTarget: true }).relatedTarget is null
+PASS new WheelEvent('eventType', { relatedTarget: '' }).relatedTarget is null
+PASS new WheelEvent('eventType', { relatedTarget: 'chocolate' }).relatedTarget is null
+PASS new WheelEvent('eventType', { relatedTarget: 12345 }).relatedTarget is null
+PASS new WheelEvent('eventType', { relatedTarget: 18446744073709551615 }).relatedTarget is null
+PASS new WheelEvent('eventType', { relatedTarget: NaN }).relatedTarget is null
+PASS new WheelEvent('eventType', { relatedTarget: {valueOf: function () { return testDiv; } } }).relatedTarget == testDiv is false
+PASS new WheelEvent('eventType', { get relatedTarget() { return 123; } }).relatedTarget is null
+PASS new WheelEvent('eventType', { get relatedTarget() { throw 'WheelEvent Error'; } }) threw exception WheelEvent Error.
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).bubbles is true
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).cancelable is true
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).view is window
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).detail is 111
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).screenX is 222
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).screenY is 333
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).clientX is 444
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).clientY is 555
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).ctrlKey is true
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).shiftKey is true
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).altKey is true
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).metaKey is true
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).button is 666
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).relatedTarget is testDiv
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).wheelDeltaX is 777
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).wheelDeltaY is 888
+PASS new WheelEvent('eventType', { bubbles: true, cancelable: true, view: window, detail: 111, screenX: 222, screenY: 333, clientX: 444, clientY: 555, ctrlKey: true, shiftKey: true, altKey: true, metaKey: true, button: 666, relatedTarget: testDiv, wheelDeltaX: 777, wheelDeltaY: 888, deltaMode: WheelEvent.DOM_DELTA_PAGE }).deltaMode is WheelEvent.DOM_DELTA_PAGE
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventscontentchangedduringdropexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/content-changed-during-drop-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/content-changed-during-drop-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/content-changed-during-drop-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,11 @@
</span><ins>+This tests that we don't lose data dropped onto an input field that changes its content during a drop event
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+ FAIL dragTarget.value should be http://example.com/. Was Original Text.
+PASS Didn't crash.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventscontextnodeselectexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/context-no-deselect-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/context-no-deselect-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/context-no-deselect-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,14 @@
</span><ins>+layer at (0,0) size 800x600
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x600
+ RenderBlock {HTML} at (0,0) size 800x600
+ RenderBody {BODY} at (8,8) size 784x584
+ RenderTextControl {INPUT} at (2,2) size 136x22 [bgcolor=#FFFFFF] [border: (1px solid #4C4C4C)]
+ RenderText {#text} at (0,0) size 0x0
+ RenderText {#text} at (0,0) size 0x0
+layer at (17,13) size 122x14
+ RenderBlock {DIV} at (6,3) size 123x15
+ RenderText {#text} at (0,0) size 87x14
+ text run at (0,0) width 87: "some sample text"
+selection start: position 5 of child 0 {#text} of child 0 {DIV} of {#document-fragment} of child 1 {INPUT} of body
+selection end: position 15 of child 0 {#text} of child 0 {DIV} of {#document-fragment} of child 1 {INPUT} of body
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventscontextonmousedowneventexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/context-onmousedown-event-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/context-onmousedown-event-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/context-onmousedown-event-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+This tests to make sure that right clicking also sends a onmousedown event.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventscontextmenuscrolledpagewithframeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/contextmenu-scrolled-page-with-frame-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/contextmenu-scrolled-page-with-frame-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/contextmenu-scrolled-page-with-frame-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+This tests that context menu events are sent to the correct frame when a page is scrolled. To test manually, scroll the page so that the top of the iframe is flush with the top of the web page area, then right-click just below the iframe. You should get a context menu that does not contain any mention of frames.
+
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventscontinuousplatformwheeleventinscrollingdivexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/continuous-platform-wheelevent-in-scrolling-div-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/continuous-platform-wheelevent-in-scrolling-div-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/continuous-platform-wheelevent-in-scrolling-div-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+FAIL div.scrollTop should be 200. Was 0.
+FAIL div.scrollLeft should be 100. Was 0.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventscontrolclicknoonclickexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/controlclick-no-onclick-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/controlclick-no-onclick-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/controlclick-no-onclick-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+This tests to make sure that a control click does not result in a click event on the Mac.
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventscrashonmutateduringdropexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/crash-on-mutate-during-drop-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/crash-on-mutate-during-drop-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/crash-on-mutate-during-drop-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+This test tests for a crash when a DOM mutation event listener modifies the text during a drop. If the test doesn't crash, all is good.
+
+drag source text
+
+drag dest text
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdatatransferfilesattributeidentityexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/data-transfer-files-attribute-identity-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/data-transfer-files-attribute-identity-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/data-transfer-files-attribute-identity-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,11 @@
</span><ins>+CONSOLE MESSAGE: line 17: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(['test.txt'])')
+
+Test that the same object is returned for dataTransfer.files each time, as well as for File objects in the FileList.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+FAIL successfullyParsed should be true (of type boolean). Was undefined (of type undefined).
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdblclickaddEventListenerexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/dblclick-addEventListener-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/dblclick-addEventListener-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/dblclick-addEventListener-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+FAILURE, no dblclick recieved
+
+Double-click above to test.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdocumentelementFromPointexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/document-elementFromPoint-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/document-elementFromPoint-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/document-elementFromPoint-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,15 @@
</span><ins>+CONSOLE MESSAGE: line 230: TypeError: null is not an object (evaluating 'target.dispatchEvent')
+FAIL: Timed out waiting for notifyDone to be called
+Absolute
+Relative
+Fixed
+x x
+Table Content
+In Columns
+Transformed
+In RTL overflow
+FAIL: event at (109, 57) expected to hit absolute at (29, 32) but hit filler at (109, 57)
+FAIL: event at (161, 13) expected to hit relative at (31, 28) but hit filler at (161, 13)
+FAIL: event at (40, 297) expected to hit table-content at (15, 18) but hit filler at (40, 297)
+FAIL: event at (122, 407) expected to hit transformed at (18, 15) but hit table-content at (77, 28)
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdomactivatesetsunderlyingclickeventashandledexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/domactivate-sets-underlying-click-event-as-handled-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/domactivate-sets-underlying-click-event-as-handled-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/domactivate-sets-underlying-click-event-as-handled-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,38 @@
</span><ins>+To test manually, click on all the form elements (except the textbox) and the details/summary element. The anchor shouldn't be activated (i.e. you shouldn't see any "anchor activated" messages).
+
+Focusing [object HTMLInputElement] type=text and pressing enter
+Activated [object HTMLInputElement] type=submit
+form submitted
+
+Focusing [object HTMLInputElement] type=submit and pressing enter
+Activated [object HTMLInputElement] type=submit
+form submitted
+
+Activated [object HTMLInputElement] type=image
+form submitted
+
+Focusing [object HTMLInputElement] type=image and pressing enter
+Activated [object HTMLInputElement] type=image
+form submitted
+
+Activated [object HTMLButtonElement] type=submit
+form submitted
+
+Focusing [object HTMLButtonElement] type=submit and pressing enter
+Activated [object HTMLButtonElement] type=submit
+form submitted
+
+Activated [object HTMLInputElement] type=reset
+Focusing [object HTMLInputElement] type=reset and pressing enter
+Activated [object HTMLInputElement] type=reset
+Activated [object HTMLButtonElement] type=reset
+Focusing [object HTMLButtonElement] type=reset and pressing enter
+Activated [object HTMLButtonElement] type=reset
+Activated [object HTMLInputElement] type=checkbox
+Activated [object HTMLInputElement] type=radio
+Activated [object HTMLInputElement] type=file
+Focusing [object HTMLInputElement] type=file and pressing enter
+Activated [object HTMLInputElement] type=file
+
+The details element was opened
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdraganddropautoscrollexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-autoscroll-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-autoscroll-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-autoscroll-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+For manual testing, drag and drop "Drop Me" to "Scrollable" area.
+Check autoscroll by drag-and-drop
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+FAIL No autoscroll
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdraganddropautoscrollinnerframeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-autoscroll-inner-frame-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-autoscroll-inner-frame-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-autoscroll-inner-frame-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,11 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+For manual testing, drag and drop "Drop Me" downwards and then upwards.
+Check autoscroll within an inner frame by drag-and-drop
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdraganddropdataTransfertypesnocrashexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-dataTransfer-types-nocrash-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-dataTransfer-types-nocrash-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-dataTransfer-types-nocrash-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+This test checks that on a successful drop we can access event.dataTransfer.types without crashing.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdraganddropexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,42 @@
</span><ins>+This test checks that drag-and-drop support works and conforms to the HTML 5 specification.
+For each effectAllowed, iterates through the possible dropEffects: none, copy, move, link, dummy.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+When effectAllowed == "uninitialized"
+
+
+When effectAllowed == "undefined"
+
+
+When effectAllowed == "none"
+
+
+When effectAllowed == "all"
+
+
+When effectAllowed == "copy"
+
+
+When effectAllowed == "move"
+
+
+When effectAllowed == "link"
+
+
+When effectAllowed == "copyMove"
+
+
+When effectAllowed == "copyLink"
+
+
+When effectAllowed == "linkMove"
+
+
+When effectAllowed == "dummy"
+
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdraganddropfiredragdragoverexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-fire-drag-dragover-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-fire-drag-dragover-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-fire-drag-dragover-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+This test checks that the event handlers ondrag and ondragover fire in that order, as per http://www.whatwg.org/specs/web-apps/current-work/#current-drag-operation.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdraganddropsetdragdataargumentsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-set-drag-data-arguments-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-set-drag-data-arguments-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-set-drag-data-arguments-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,9 @@
</span><ins>+Tests correct behavior of event.dataTransfer.setData with wrong number of arguments
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS successfullyParsed is true
+
+TEST COMPLETE
+Drag me
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdraganddropsubframedataTransferexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-subframe-dataTransfer-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-subframe-dataTransfer-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-and-drop-subframe-dataTransfer-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+Dragging this iframe onto a drop target should not expose its contents.
+→ ←
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdragcustomDataexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-customData-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-customData-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-customData-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,6 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+To manually test, drag 'Drag Me' to 'Drop Here' and drop. The word 'SUCCESS' should appear.
+
+Drag Me
+Drop Here
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdragdataTransferItemListexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-dataTransferItemList-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-dataTransferItemList-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-dataTransferItemList-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,9 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+To manually test, drag 'Drag Me' to 'Drop Here' and drop. Several lines that say 'PASS' should appear below.
+
+Drag Me
+Drop Here
+Drag handler:
+Drop handler:
+Running test with Legacy drag handler and Legacy drop handler
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdragdataTransferItemListfilehandlingexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-dataTransferItemList-file-handling-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-dataTransferItemList-file-handling-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-dataTransferItemList-file-handling-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,7 @@
</span><ins>+CONSOLE MESSAGE: line 58: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(['test.txt'])')
+FAIL: Timed out waiting for notifyDone to be called
+To manually test, select a text file for the file input element, and then drag 'Drag Me' to 'Drop Here' and drop. Several lines that say 'PASS' should appear below.
+
+Drag Me
+Drop Here
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdragdisplaynoneelementexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-display-none-element-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-display-none-element-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-display-none-element-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+To test, try dragging this div around. It shouldn't crash, the div should disappear and PASS should appear.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdragfilecrashexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-file-crash-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-file-crash-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-file-crash-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+CONSOLE MESSAGE: line 21: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(["resources/abe.png"])')
+ This is a test for https://bugs.webkit.org/show_bug.cgi?id=29276. It passes if it does not crash. If not run from DRT, drag a file onto the file input.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdragimagefilenameexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-image-filename-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-image-filename-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-image-filename-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+This test requires DumpRenderTree. To test manually, drag the image to the desktop. It should receive the name "onload-image.png".
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdraginframesexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-in-frames-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-in-frames-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-in-frames-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+Event log
+
+These results are just "sensible" at the moment, meaning that all the events fire on the right elements, nothing more. The order in particular can rightfully change.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdraglinkexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-link-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-link-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-link-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+Test for bug 70277. This tests that a link is dragged and dropped properly in an already focused editable area. This test passes only if it does not hit an assertion.
+
+Test Link
+Editable area
+
+
+
+PASS
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdragoutsidewindowexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-outside-window-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-outside-window-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-outside-window-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+ALERT: Test result: FAIL
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdragparentnodeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-parent-node-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-parent-node-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-parent-node-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+This tests a parent node (has child nodes) is draggable. You should be able to drag the bookmark image below and drop it to bookmarks bar.
+
+Bookmark
+
+Test failed.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdragselectsimageexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-selects-image-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-selects-image-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-selects-image-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,15 @@
</span><ins>+Non-editable area
+
+
+Editable area
+
+
+This tests that images are properly left selected or unselected when an image drag is started. Only the image in the editable area should be selected when an image drag is started.
+
+Starting test...
+0 range(s) selected
+Dragging image in non-editable area...
+0 range(s) selected
+Dragging image in editable area...
+0 range(s) selected
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdragtonavigateexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drag-to-navigate-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drag-to-navigate-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drag-to-navigate-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+CONSOLE MESSAGE: line 6: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(["resources/file-for-drag-to-navigate.html"])')
+FAIL: Timed out waiting for notifyDone to be called
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdrophandlershouldnotstopnavigateexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drop-handler-should-not-stop-navigate-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drop-handler-should-not-stop-navigate-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drop-handler-should-not-stop-navigate-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+CONSOLE MESSAGE: line 38: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(['DRTFakeFile'])')
+FAIL: Timed out waiting for notifyDone to be called
+This tests that a drop handler's default action must be prevented in order to stop navigation. Otherwise, if event.preventDefault() is not called, navigation should occur. To test manually, simply drag and drop another link or HTML file on this page. If navigation occurs, then the test passed.
+
+Starting test
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdropwithfilepathsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/drop-with-file-paths-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/drop-with-file-paths-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/drop-with-file-paths-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+CONSOLE MESSAGE: line 11: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(['resources/file-for-drop-with-file-paths.html'])')
+Drop files anywhere on this page. The page will try to intercept the drop--it should succeed but not be able to use dataTransfer.getData
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdropzone001expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-001-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-001-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-001-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,42 @@
</span><ins>+This test checks that drag-and-drop support works and conforms to the HTML 5 specification.
+For each effectAllowed, iterates through the possible dropEffects: none, copy, move, link, dummy.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+When effectAllowed == "uninitialized"
+
+
+When effectAllowed == "undefined"
+
+
+When effectAllowed == "none"
+
+
+When effectAllowed == "all"
+
+
+When effectAllowed == "copy"
+
+
+When effectAllowed == "move"
+
+
+When effectAllowed == "link"
+
+
+When effectAllowed == "copyMove"
+
+
+When effectAllowed == "copyLink"
+
+
+When effectAllowed == "linkMove"
+
+
+When effectAllowed == "dummy"
+
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdropzone002expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-002-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-002-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-002-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+This test checks that drag-and-drop support works with images.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdropzone003expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-003-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-003-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-003-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+This test checks that drag-and-drop support works with a elements.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdropzone004expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-004-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-004-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-004-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+CONSOLE MESSAGE: line 58: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(["resources/file-for-prevent-drag-to-navigate.html"])')
+This test checks that drag-and-drop support works with files.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Drop the file onto me.
+
+Expects dropEffect
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsdropzone005expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-005-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-005-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/dropzone-005-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+This test checks that dragging an image on to a drop zone doesn't match string:url.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventseventattributeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/event-attribute-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/event-attribute-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/event-attribute-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,274 @@
</span><ins>+Test that setting event handlers with attribute works.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+cancelled onbeforeload async
+PASS /*img*/ typeof (element["onclick"]) is "function"
+PASS /*img*/ typeof (element["oncontextmenu"]) is "function"
+PASS /*img*/ typeof (element["ondblclick"]) is "function"
+PASS /*img*/ typeof (element["onmousedown"]) is "function"
+PASS /*img*/ typeof (element["onmousemove"]) is "function"
+PASS /*img*/ typeof (element["onmouseout"]) is "function"
+PASS /*img*/ typeof (element["onmouseover"]) is "function"
+PASS /*img*/ typeof (element["onmouseup"]) is "function"
+PASS /*img*/ typeof (element["onmousewheel"]) is "function"
+PASS /*img*/ typeof (element["onfocus"]) is "function"
+PASS /*img*/ typeof (element["onblur"]) is "function"
+PASS /*img*/ typeof (element["onkeydown"]) is "function"
+PASS /*img*/ typeof (element["onkeypress"]) is "function"
+PASS /*img*/ typeof (element["onkeyup"]) is "function"
+PASS /*img*/ typeof (element["onscroll"]) is "function"
+PASS /*img*/ typeof (element["onbeforecut"]) is "function"
+PASS /*img*/ typeof (element["oncut"]) is "function"
+PASS /*img*/ typeof (element["onbeforecopy"]) is "function"
+PASS /*img*/ typeof (element["oncopy"]) is "function"
+PASS /*img*/ typeof (element["onbeforepaste"]) is "function"
+PASS /*img*/ typeof (element["onpaste"]) is "function"
+PASS /*img*/ typeof (element["ondragenter"]) is "function"
+PASS /*img*/ typeof (element["ondragover"]) is "function"
+PASS /*img*/ typeof (element["ondragleave"]) is "function"
+PASS /*img*/ typeof (element["ondrop"]) is "function"
+PASS /*img*/ typeof (element["ondragstart"]) is "function"
+PASS /*img*/ typeof (element["ondrag"]) is "function"
+PASS /*img*/ typeof (element["ondragend"]) is "function"
+PASS /*img*/ typeof (element["onselectstart"]) is "function"
+PASS /*img*/ typeof (element["onsubmit"]) is "function"
+PASS /*img*/ typeof (element["onerror"]) is "function"
+PASS /*img*/ typeof (element["oninput"]) is "function"
+PASS /*img*/ typeof (element["oninvalid"]) is "function"
+PASS /*img*/ typeof (element["ontouchstart"]) is "function"
+PASS /*img*/ typeof (element["ontouchmove"]) is "function"
+PASS /*img*/ typeof (element["ontouchend"]) is "function"
+PASS /*img*/ typeof (element["ontouchcancel"]) is "function"
+FAIL /*img*/ typeof (element["onwebkitfullscreenchange"]) should be function. Was undefined.
+FAIL /*img*/ typeof (element["onwebkitfullscreenerror"]) should be function. Was undefined.
+PASS /*img*/ typeof (element["onabort"]) is "function"
+PASS /*img*/ typeof (element["onchange"]) is "function"
+PASS /*img*/ typeof (element["onreset"]) is "function"
+PASS /*img*/ typeof (element["onselect"]) is "function"
+PASS /*img*/ typeof (element["onload"]) is "function"
+PASS /*script*/ typeof (element["onclick"]) is "function"
+PASS /*script*/ typeof (element["oncontextmenu"]) is "function"
+PASS /*script*/ typeof (element["ondblclick"]) is "function"
+PASS /*script*/ typeof (element["onmousedown"]) is "function"
+PASS /*script*/ typeof (element["onmousemove"]) is "function"
+PASS /*script*/ typeof (element["onmouseout"]) is "function"
+PASS /*script*/ typeof (element["onmouseover"]) is "function"
+PASS /*script*/ typeof (element["onmouseup"]) is "function"
+PASS /*script*/ typeof (element["onmousewheel"]) is "function"
+PASS /*script*/ typeof (element["onfocus"]) is "function"
+PASS /*script*/ typeof (element["onblur"]) is "function"
+PASS /*script*/ typeof (element["onkeydown"]) is "function"
+PASS /*script*/ typeof (element["onkeypress"]) is "function"
+PASS /*script*/ typeof (element["onkeyup"]) is "function"
+PASS /*script*/ typeof (element["onscroll"]) is "function"
+PASS /*script*/ typeof (element["onbeforecut"]) is "function"
+PASS /*script*/ typeof (element["oncut"]) is "function"
+PASS /*script*/ typeof (element["onbeforecopy"]) is "function"
+PASS /*script*/ typeof (element["oncopy"]) is "function"
+PASS /*script*/ typeof (element["onbeforepaste"]) is "function"
+PASS /*script*/ typeof (element["onpaste"]) is "function"
+PASS /*script*/ typeof (element["ondragenter"]) is "function"
+PASS /*script*/ typeof (element["ondragover"]) is "function"
+PASS /*script*/ typeof (element["ondragleave"]) is "function"
+PASS /*script*/ typeof (element["ondrop"]) is "function"
+PASS /*script*/ typeof (element["ondragstart"]) is "function"
+PASS /*script*/ typeof (element["ondrag"]) is "function"
+PASS /*script*/ typeof (element["ondragend"]) is "function"
+PASS /*script*/ typeof (element["onselectstart"]) is "function"
+PASS /*script*/ typeof (element["onsubmit"]) is "function"
+PASS /*script*/ typeof (element["onerror"]) is "function"
+PASS /*script*/ typeof (element["oninput"]) is "function"
+PASS /*script*/ typeof (element["oninvalid"]) is "function"
+PASS /*script*/ typeof (element["ontouchstart"]) is "function"
+PASS /*script*/ typeof (element["ontouchmove"]) is "function"
+PASS /*script*/ typeof (element["ontouchend"]) is "function"
+PASS /*script*/ typeof (element["ontouchcancel"]) is "function"
+FAIL /*script*/ typeof (element["onwebkitfullscreenchange"]) should be function. Was undefined.
+FAIL /*script*/ typeof (element["onwebkitfullscreenerror"]) should be function. Was undefined.
+PASS /*script*/ typeof (element["onabort"]) is "function"
+PASS /*script*/ typeof (element["onchange"]) is "function"
+PASS /*script*/ typeof (element["onreset"]) is "function"
+PASS /*script*/ typeof (element["onselect"]) is "function"
+PASS /*script*/ typeof (element["onload"]) is "function"
+PASS /*video*/ typeof (element["onclick"]) is "function"
+PASS /*video*/ typeof (element["oncontextmenu"]) is "function"
+PASS /*video*/ typeof (element["ondblclick"]) is "function"
+PASS /*video*/ typeof (element["onmousedown"]) is "function"
+PASS /*video*/ typeof (element["onmousemove"]) is "function"
+PASS /*video*/ typeof (element["onmouseout"]) is "function"
+PASS /*video*/ typeof (element["onmouseover"]) is "function"
+PASS /*video*/ typeof (element["onmouseup"]) is "function"
+PASS /*video*/ typeof (element["onmousewheel"]) is "function"
+PASS /*video*/ typeof (element["onfocus"]) is "function"
+PASS /*video*/ typeof (element["onblur"]) is "function"
+PASS /*video*/ typeof (element["onkeydown"]) is "function"
+PASS /*video*/ typeof (element["onkeypress"]) is "function"
+PASS /*video*/ typeof (element["onkeyup"]) is "function"
+PASS /*video*/ typeof (element["onscroll"]) is "function"
+PASS /*video*/ typeof (element["onbeforecut"]) is "function"
+PASS /*video*/ typeof (element["oncut"]) is "function"
+PASS /*video*/ typeof (element["onbeforecopy"]) is "function"
+PASS /*video*/ typeof (element["oncopy"]) is "function"
+PASS /*video*/ typeof (element["onbeforepaste"]) is "function"
+PASS /*video*/ typeof (element["onpaste"]) is "function"
+PASS /*video*/ typeof (element["ondragenter"]) is "function"
+PASS /*video*/ typeof (element["ondragover"]) is "function"
+PASS /*video*/ typeof (element["ondragleave"]) is "function"
+PASS /*video*/ typeof (element["ondrop"]) is "function"
+PASS /*video*/ typeof (element["ondragstart"]) is "function"
+PASS /*video*/ typeof (element["ondrag"]) is "function"
+PASS /*video*/ typeof (element["ondragend"]) is "function"
+PASS /*video*/ typeof (element["onselectstart"]) is "function"
+PASS /*video*/ typeof (element["onsubmit"]) is "function"
+PASS /*video*/ typeof (element["onerror"]) is "function"
+PASS /*video*/ typeof (element["oninput"]) is "function"
+PASS /*video*/ typeof (element["oninvalid"]) is "function"
+PASS /*video*/ typeof (element["ontouchstart"]) is "function"
+PASS /*video*/ typeof (element["ontouchmove"]) is "function"
+PASS /*video*/ typeof (element["ontouchend"]) is "function"
+PASS /*video*/ typeof (element["ontouchcancel"]) is "function"
+FAIL /*video*/ typeof (element["onwebkitfullscreenchange"]) should be function. Was undefined.
+FAIL /*video*/ typeof (element["onwebkitfullscreenerror"]) should be function. Was undefined.
+PASS /*video*/ typeof (element["onabort"]) is "function"
+PASS /*video*/ typeof (element["onchange"]) is "function"
+PASS /*video*/ typeof (element["onreset"]) is "function"
+PASS /*video*/ typeof (element["onselect"]) is "function"
+PASS /*video*/ typeof (element["onload"]) is "function"
+PASS /*div*/ typeof (element["onclick"]) is "function"
+PASS /*div*/ typeof (element["oncontextmenu"]) is "function"
+PASS /*div*/ typeof (element["ondblclick"]) is "function"
+PASS /*div*/ typeof (element["onmousedown"]) is "function"
+PASS /*div*/ typeof (element["onmousemove"]) is "function"
+PASS /*div*/ typeof (element["onmouseout"]) is "function"
+PASS /*div*/ typeof (element["onmouseover"]) is "function"
+PASS /*div*/ typeof (element["onmouseup"]) is "function"
+PASS /*div*/ typeof (element["onmousewheel"]) is "function"
+PASS /*div*/ typeof (element["onfocus"]) is "function"
+PASS /*div*/ typeof (element["onblur"]) is "function"
+PASS /*div*/ typeof (element["onkeydown"]) is "function"
+PASS /*div*/ typeof (element["onkeypress"]) is "function"
+PASS /*div*/ typeof (element["onkeyup"]) is "function"
+PASS /*div*/ typeof (element["onscroll"]) is "function"
+PASS /*div*/ typeof (element["onbeforecut"]) is "function"
+PASS /*div*/ typeof (element["oncut"]) is "function"
+PASS /*div*/ typeof (element["onbeforecopy"]) is "function"
+PASS /*div*/ typeof (element["oncopy"]) is "function"
+PASS /*div*/ typeof (element["onbeforepaste"]) is "function"
+PASS /*div*/ typeof (element["onpaste"]) is "function"
+PASS /*div*/ typeof (element["ondragenter"]) is "function"
+PASS /*div*/ typeof (element["ondragover"]) is "function"
+PASS /*div*/ typeof (element["ondragleave"]) is "function"
+PASS /*div*/ typeof (element["ondrop"]) is "function"
+PASS /*div*/ typeof (element["ondragstart"]) is "function"
+PASS /*div*/ typeof (element["ondrag"]) is "function"
+PASS /*div*/ typeof (element["ondragend"]) is "function"
+PASS /*div*/ typeof (element["onselectstart"]) is "function"
+PASS /*div*/ typeof (element["onsubmit"]) is "function"
+PASS /*div*/ typeof (element["onerror"]) is "function"
+PASS /*div*/ typeof (element["oninput"]) is "function"
+PASS /*div*/ typeof (element["oninvalid"]) is "function"
+PASS /*div*/ typeof (element["ontouchstart"]) is "function"
+PASS /*div*/ typeof (element["ontouchmove"]) is "function"
+PASS /*div*/ typeof (element["ontouchend"]) is "function"
+PASS /*div*/ typeof (element["ontouchcancel"]) is "function"
+FAIL /*div*/ typeof (element["onwebkitfullscreenchange"]) should be function. Was undefined.
+FAIL /*div*/ typeof (element["onwebkitfullscreenerror"]) should be function. Was undefined.
+PASS /*div*/ typeof (element["onabort"]) is "function"
+PASS /*div*/ typeof (element["onchange"]) is "function"
+PASS /*div*/ typeof (element["onreset"]) is "function"
+PASS /*div*/ typeof (element["onselect"]) is "function"
+PASS /*div*/ typeof (element["onload"]) is "function"
+PASS /*form*/ typeof (element["onclick"]) is "function"
+PASS /*form*/ typeof (element["oncontextmenu"]) is "function"
+PASS /*form*/ typeof (element["ondblclick"]) is "function"
+PASS /*form*/ typeof (element["onmousedown"]) is "function"
+PASS /*form*/ typeof (element["onmousemove"]) is "function"
+PASS /*form*/ typeof (element["onmouseout"]) is "function"
+PASS /*form*/ typeof (element["onmouseover"]) is "function"
+PASS /*form*/ typeof (element["onmouseup"]) is "function"
+PASS /*form*/ typeof (element["onmousewheel"]) is "function"
+PASS /*form*/ typeof (element["onfocus"]) is "function"
+PASS /*form*/ typeof (element["onblur"]) is "function"
+PASS /*form*/ typeof (element["onkeydown"]) is "function"
+PASS /*form*/ typeof (element["onkeypress"]) is "function"
+PASS /*form*/ typeof (element["onkeyup"]) is "function"
+PASS /*form*/ typeof (element["onscroll"]) is "function"
+PASS /*form*/ typeof (element["onbeforecut"]) is "function"
+PASS /*form*/ typeof (element["oncut"]) is "function"
+PASS /*form*/ typeof (element["onbeforecopy"]) is "function"
+PASS /*form*/ typeof (element["oncopy"]) is "function"
+PASS /*form*/ typeof (element["onbeforepaste"]) is "function"
+PASS /*form*/ typeof (element["onpaste"]) is "function"
+PASS /*form*/ typeof (element["ondragenter"]) is "function"
+PASS /*form*/ typeof (element["ondragover"]) is "function"
+PASS /*form*/ typeof (element["ondragleave"]) is "function"
+PASS /*form*/ typeof (element["ondrop"]) is "function"
+PASS /*form*/ typeof (element["ondragstart"]) is "function"
+PASS /*form*/ typeof (element["ondrag"]) is "function"
+PASS /*form*/ typeof (element["ondragend"]) is "function"
+PASS /*form*/ typeof (element["onselectstart"]) is "function"
+PASS /*form*/ typeof (element["onsubmit"]) is "function"
+PASS /*form*/ typeof (element["onerror"]) is "function"
+PASS /*form*/ typeof (element["oninput"]) is "function"
+PASS /*form*/ typeof (element["oninvalid"]) is "function"
+PASS /*form*/ typeof (element["ontouchstart"]) is "function"
+PASS /*form*/ typeof (element["ontouchmove"]) is "function"
+PASS /*form*/ typeof (element["ontouchend"]) is "function"
+PASS /*form*/ typeof (element["ontouchcancel"]) is "function"
+FAIL /*form*/ typeof (element["onwebkitfullscreenchange"]) should be function. Was undefined.
+FAIL /*form*/ typeof (element["onwebkitfullscreenerror"]) should be function. Was undefined.
+PASS /*form*/ typeof (element["onabort"]) is "function"
+PASS /*form*/ typeof (element["onchange"]) is "function"
+PASS /*form*/ typeof (element["onreset"]) is "function"
+PASS /*form*/ typeof (element["onselect"]) is "function"
+PASS /*form*/ typeof (element["onload"]) is "function"
+PASS /*input*/ typeof (element["onclick"]) is "function"
+PASS /*input*/ typeof (element["oncontextmenu"]) is "function"
+PASS /*input*/ typeof (element["ondblclick"]) is "function"
+PASS /*input*/ typeof (element["onmousedown"]) is "function"
+PASS /*input*/ typeof (element["onmousemove"]) is "function"
+PASS /*input*/ typeof (element["onmouseout"]) is "function"
+PASS /*input*/ typeof (element["onmouseover"]) is "function"
+PASS /*input*/ typeof (element["onmouseup"]) is "function"
+PASS /*input*/ typeof (element["onmousewheel"]) is "function"
+PASS /*input*/ typeof (element["onfocus"]) is "function"
+PASS /*input*/ typeof (element["onblur"]) is "function"
+PASS /*input*/ typeof (element["onkeydown"]) is "function"
+PASS /*input*/ typeof (element["onkeypress"]) is "function"
+PASS /*input*/ typeof (element["onkeyup"]) is "function"
+PASS /*input*/ typeof (element["onscroll"]) is "function"
+PASS /*input*/ typeof (element["onbeforecut"]) is "function"
+PASS /*input*/ typeof (element["oncut"]) is "function"
+PASS /*input*/ typeof (element["onbeforecopy"]) is "function"
+PASS /*input*/ typeof (element["oncopy"]) is "function"
+PASS /*input*/ typeof (element["onbeforepaste"]) is "function"
+PASS /*input*/ typeof (element["onpaste"]) is "function"
+PASS /*input*/ typeof (element["ondragenter"]) is "function"
+PASS /*input*/ typeof (element["ondragover"]) is "function"
+PASS /*input*/ typeof (element["ondragleave"]) is "function"
+PASS /*input*/ typeof (element["ondrop"]) is "function"
+PASS /*input*/ typeof (element["ondragstart"]) is "function"
+PASS /*input*/ typeof (element["ondrag"]) is "function"
+PASS /*input*/ typeof (element["ondragend"]) is "function"
+PASS /*input*/ typeof (element["onselectstart"]) is "function"
+PASS /*input*/ typeof (element["onsubmit"]) is "function"
+PASS /*input*/ typeof (element["onerror"]) is "function"
+PASS /*input*/ typeof (element["oninput"]) is "function"
+PASS /*input*/ typeof (element["oninvalid"]) is "function"
+PASS /*input*/ typeof (element["ontouchstart"]) is "function"
+PASS /*input*/ typeof (element["ontouchmove"]) is "function"
+PASS /*input*/ typeof (element["ontouchend"]) is "function"
+PASS /*input*/ typeof (element["ontouchcancel"]) is "function"
+FAIL /*input*/ typeof (element["onwebkitfullscreenchange"]) should be function. Was undefined.
+FAIL /*input*/ typeof (element["onwebkitfullscreenerror"]) should be function. Was undefined.
+PASS /*input*/ typeof (element["onabort"]) is "function"
+PASS /*input*/ typeof (element["onchange"]) is "function"
+PASS /*input*/ typeof (element["onreset"]) is "function"
+PASS /*input*/ typeof (element["onselect"]) is "function"
+PASS /*input*/ typeof (element["onload"]) is "function"
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventseventlisteneronlinkexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/event-listener-on-link-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/event-listener-on-link-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/event-listener-on-link-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+layer at (0,0) size 800x600
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x600
+ RenderBlock {HTML} at (0,0) size 800x600
+ RenderBody {BODY} at (8,8) size 784x584
+ RenderText {#text} at (0,0) size 782x39
+ text run at (0,0) width 782: "This tests that you can successfully add a DOMSubtreeModified event listener to a link element, and the page should load"
+ text run at (0,20) width 112: "without crashing."
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsfileinputhiddeninondropexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/file-input-hidden-in-ondrop-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/file-input-hidden-in-ondrop-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/file-input-hidden-in-ondrop-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+CONSOLE MESSAGE: line 26: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(["resources/abe.png"])')
+FAIL: Timed out waiting for notifyDone to be called
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsfiremousedownwhilepressingmousebuttonexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/fire-mousedown-while-pressing-mouse-button-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/fire-mousedown-while-pressing-mouse-button-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/fire-mousedown-while-pressing-mouse-button-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,17 @@
</span><ins>+This test verifies that we fire a mousedown event whenever pressing and holding a mouse button A while simultaneously clicking with mouse button B, where A != B.
+For each mouse button that is pressed and held, iterates through the possible second mouse buttons that can be clicked.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+FAIL didn't receive mousedown for the middle mouse button while pressing the left mouse button.
+FAIL didn't receive mousedown for the right mouse button while pressing the left mouse button.
+
+When pressing and holding the "middle mouse button"
+
+
+When pressing and holding the "right mouse button"
+
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsfirescrolleventexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/fire-scroll-event-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/fire-scroll-event-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/fire-scroll-event-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,11 @@
</span><ins>+Checks that the scroll event fires on the document asychronously and only once.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Scroll event bubbles: true
+PASS Scroll position: (0, 0)
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsfocuschangecrashexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/focus-change-crash-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/focus-change-crash-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/focus-change-crash-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+Type something into the first input and press tab. The browser should not crash.
+
+PASSED
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsframescrollfakemousemoveexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/frame-scroll-fake-mouse-move-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/frame-scroll-fake-mouse-move-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/frame-scroll-fake-mouse-move-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1 @@
</span><ins>+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsframetabfocusexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/frame-tab-focus-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/frame-tab-focus-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/frame-tab-focus-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,98 @@
</span><ins>+This page tests tabbing between subframes. To test, click on this text to focus the main window. Then press Tab 7 times, then Shift-Tab 7 times, which should move focus forward and backward through all inputs and frames. Then press Option-Tab 11 times and Shift-Option-Tab 11 times, which should move focus forward and backward through all inputs, frames, and links.
+
+ [tabindex of one] [tabindex of three] [tabindex of two] [tabindex of three]
+Tabbing forward...
+
+main window: INPUT #2 (tabindex=2) focused
+main window: INPUT #2 (tabindex=2) blurred
+main window: INPUT #1 (tabindex=3) focused
+main window: INPUT #1 (tabindex=3) blurred
+main window: INPUT #0 (tabindex=0) focused
+main window: INPUT #0 (tabindex=0) blurred
+main window: INPUT #3 (tabindex=0) focused
+main window: INPUT #3 (tabindex=0) blurred
+main window: window blurred
+main window: window focused
+main window: INPUT #2 (tabindex=2) focused
+main window: INPUT #2 (tabindex=2) blurred
+main window: INPUT #1 (tabindex=3) focused
+main window: INPUT #1 (tabindex=3) blurred
+main window: INPUT #0 (tabindex=0) focused
+main window: INPUT #0 (tabindex=0) blurred
+
+Tabbing backward...
+
+main window: INPUT #3 (tabindex=0) focused
+main window: INPUT #3 (tabindex=0) blurred
+main window: INPUT #0 (tabindex=0) focused
+main window: INPUT #0 (tabindex=0) blurred
+main window: INPUT #1 (tabindex=3) focused
+main window: INPUT #1 (tabindex=3) blurred
+main window: INPUT #2 (tabindex=2) focused
+main window: INPUT #2 (tabindex=2) blurred
+main window: window blurred
+main window: window focused
+main window: INPUT #3 (tabindex=0) focused
+main window: INPUT #3 (tabindex=0) blurred
+main window: INPUT #0 (tabindex=0) focused
+main window: INPUT #0 (tabindex=0) blurred
+main window: INPUT #1 (tabindex=3) focused
+main window: INPUT #1 (tabindex=3) blurred
+
+Option-tabbing forward...
+
+main window: A #0 (tabindex=1) focused
+main window: A #0 (tabindex=1) blurred
+main window: INPUT #2 (tabindex=2) focused
+main window: INPUT #2 (tabindex=2) blurred
+main window: A #2 (tabindex=2) focused
+main window: A #2 (tabindex=2) blurred
+main window: INPUT #1 (tabindex=3) focused
+main window: INPUT #1 (tabindex=3) blurred
+main window: A #1 (tabindex=3) focused
+main window: A #1 (tabindex=3) blurred
+main window: A #3 (tabindex=3) focused
+main window: A #3 (tabindex=3) blurred
+main window: INPUT #0 (tabindex=0) focused
+main window: INPUT #0 (tabindex=0) blurred
+main window: INPUT #3 (tabindex=0) focused
+main window: INPUT #3 (tabindex=0) blurred
+main window: window blurred
+main window: window focused
+main window: A #0 (tabindex=1) focused
+main window: A #0 (tabindex=1) blurred
+main window: INPUT #2 (tabindex=2) focused
+main window: INPUT #2 (tabindex=2) blurred
+main window: A #2 (tabindex=2) focused
+main window: A #2 (tabindex=2) blurred
+
+Option-tabbing backward...
+
+main window: INPUT #3 (tabindex=0) focused
+main window: INPUT #3 (tabindex=0) blurred
+main window: INPUT #0 (tabindex=0) focused
+main window: INPUT #0 (tabindex=0) blurred
+main window: A #3 (tabindex=3) focused
+main window: A #3 (tabindex=3) blurred
+main window: A #1 (tabindex=3) focused
+main window: A #1 (tabindex=3) blurred
+main window: INPUT #1 (tabindex=3) focused
+main window: INPUT #1 (tabindex=3) blurred
+main window: A #2 (tabindex=2) focused
+main window: A #2 (tabindex=2) blurred
+main window: INPUT #2 (tabindex=2) focused
+main window: INPUT #2 (tabindex=2) blurred
+main window: A #0 (tabindex=1) focused
+main window: A #0 (tabindex=1) blurred
+main window: window blurred
+main window: window focused
+main window: INPUT #3 (tabindex=0) focused
+main window: INPUT #3 (tabindex=0) blurred
+main window: INPUT #0 (tabindex=0) focused
+main window: INPUT #0 (tabindex=0) blurred
+main window: A #3 (tabindex=3) focused
+main window: A #3 (tabindex=3) blurred
+
+Test finished
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsimecompositionevents001expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/ime-composition-events-001-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/ime-composition-events-001-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/ime-composition-events-001-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,7 @@
</span><ins>+CONSOLE MESSAGE: line 40: ReferenceError: Can't find variable: textInputController
+This tests that calling input-method functions sends Composition Events and Text Events introduced in DOM Level 3.
+
+To test manually, enable an IME, input CJK characters, and see this page doesn't show 'FAILED' lines.
+
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsinputelementdisplaynoneindragleavecrashexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/input-element-display-none-in-dragleave-crash-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/input-element-display-none-in-dragleave-crash-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/input-element-display-none-in-dragleave-crash-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+CONSOLE MESSAGE: line 18: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(["resources/abe.png"])')
+FAIL: Timed out waiting for notifyDone to be called
+This test passes if there is no crash when dragging a file over and then away from the file input element below.
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsinputimagescrolledxyexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/input-image-scrolled-x-y-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/input-image-scrolled-x-y-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/input-image-scrolled-x-y-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsinputTextneverfiredonkeydowncancelexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/inputText-never-fired-on-keydown-cancel-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/inputText-never-fired-on-keydown-cancel-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/inputText-never-fired-on-keydown-cancel-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,15 @@
</span><ins>+Test that ensure textInput events should not fired when preceding key events are cancelled
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+FAIL window.targetNode should be null. Was [object HTMLInputElement].
+FAIL null should be [object HTMLInputElement]. Was null.
+FAIL window.targetNode should be null. Was [object HTMLTextAreaElement].
+PASS null is receivedEventTarget
+FAIL window.targetNode should be null. Was [object HTMLDivElement].
+PASS null is receivedEventTarget
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventskeyeventsininputbuttonexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/key-events-in-input-button-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/key-events-in-input-button-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/key-events-in-input-button-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,19 @@
</span><ins>+To test manually, press keys and compare results to other browsers.
+
+
+target - type - ctrlKey,altKey,shiftKey,metaKey - keyIdentifier - keyCode - charCode
+Space:
+INPUT - keydown - false,false,false,false - U+0020 - 32 - 0
+INPUT - keypress - false,false,false,false - - 32 - 32
+INPUT - keyup - false,false,false,false - U+0020 - 32 - 0
+INPUT - click
+Enter:
+INPUT - keydown - false,false,false,false - Enter - 13 - 0
+INPUT - keypress - false,false,false,false - - 13 - 13
+INPUT - click
+INPUT - keyup - false,false,false,false - Enter - 13 - 0
+A:
+INPUT - keydown - false,false,false,false - U+0041 - 65 - 0
+INPUT - keypress - false,false,false,false - - 65 - 65
+INPUT - keyup - false,false,false,false - U+0041 - 65 - 0
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventskeyeventsininputtextexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/key-events-in-input-text-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/key-events-in-input-text-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/key-events-in-input-text-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,18 @@
</span><ins>+To test manually, press keys and compare results to other browsers.
+
+
+target - type - ctrlKey,altKey,shiftKey,metaKey - keyIdentifier - keyCode - charCode
+Space:
+INPUT - keydown - false,false,false,false - U+0020 - 32 - 0. Value: "".
+INPUT - keypress - false,false,false,false - - 32 - 32. Value: "".
+INPUT - keyup - false,false,false,false - U+0020 - 32 - 0. Value: "".
+Backspace:
+INPUT - keydown - false,false,false,false - U+0008 - 8 - 0. Value: "".
+INPUT - textInput - . Value: "".
+INPUT - keyup - false,false,false,false - U+0008 - 8 - 0. Value: "".
+Left Arrow:
+INPUT - keydown - false,false,false,false - Left - 37 - 0. Value: "".
+INPUT - keyup - false,false,false,false - Left - 37 - 0. Value: "".
+Tab:
+INPUT - keydown - false,false,false,false - U+0009 - 9 - 0. Value: "".
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventskeydown1expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-1-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-1-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-1-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,6 @@
</span><ins>+This tests that keydown events aren't sent to the main frame for command key presses that occur when a subframe is first responder. To run it manually, click inside the subframe, type a few characters, then do Command-A to Select All. Only the subframe should report a keydown event.
+
+
+keydown in subframe: [object KeyboardEvent]
+keydown in subframe: [object KeyboardEvent]
+This sentence should not end with a period.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventskeydownleftrightkeysexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-leftright-keys-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-leftright-keys-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-leftright-keys-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,28 @@
</span><ins>+
+This tests keyboard events with KeyLocationCode argument.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS lastKeyboardEvent.type is "keydown"
+FAIL lastKeyboardEvent.keyCode should be 16. Was 0.
+FAIL lastKeyboardEvent.location should be 1. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+FAIL lastKeyboardEvent.keyCode should be 17. Was 0.
+FAIL lastKeyboardEvent.location should be 1. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+FAIL lastKeyboardEvent.keyCode should be 18. Was 0.
+FAIL lastKeyboardEvent.location should be 1. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+FAIL lastKeyboardEvent.keyCode should be 16. Was 0.
+FAIL lastKeyboardEvent.location should be 2. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+FAIL lastKeyboardEvent.keyCode should be 17. Was 0.
+FAIL lastKeyboardEvent.location should be 2. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+FAIL lastKeyboardEvent.keyCode should be 18. Was 0.
+FAIL lastKeyboardEvent.location should be 2. Was 0.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventskeydownnumpadkeysexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-numpad-keys-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-numpad-keys-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/keydown-numpad-keys-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,70 @@
</span><ins>+
+This tests keyboard events with KeyLocationCode argument.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 33
+PASS lastKeyboardEvent.location is KeyboardEvent.DOM_KEY_LOCATION_STANDARD
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 34
+PASS lastKeyboardEvent.location is KeyboardEvent.DOM_KEY_LOCATION_STANDARD
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 36
+PASS lastKeyboardEvent.location is KeyboardEvent.DOM_KEY_LOCATION_STANDARD
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 35
+PASS lastKeyboardEvent.location is KeyboardEvent.DOM_KEY_LOCATION_STANDARD
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 37
+PASS lastKeyboardEvent.location is KeyboardEvent.DOM_KEY_LOCATION_STANDARD
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 39
+PASS lastKeyboardEvent.location is KeyboardEvent.DOM_KEY_LOCATION_STANDARD
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 38
+PASS lastKeyboardEvent.location is KeyboardEvent.DOM_KEY_LOCATION_STANDARD
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 40
+PASS lastKeyboardEvent.location is KeyboardEvent.DOM_KEY_LOCATION_STANDARD
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 45
+PASS lastKeyboardEvent.location is KeyboardEvent.DOM_KEY_LOCATION_STANDARD
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 46
+PASS lastKeyboardEvent.location is KeyboardEvent.DOM_KEY_LOCATION_STANDARD
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 33
+FAIL lastKeyboardEvent.location should be 3. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 34
+FAIL lastKeyboardEvent.location should be 3. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 36
+FAIL lastKeyboardEvent.location should be 3. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 35
+FAIL lastKeyboardEvent.location should be 3. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 37
+FAIL lastKeyboardEvent.location should be 3. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 39
+FAIL lastKeyboardEvent.location should be 3. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 38
+FAIL lastKeyboardEvent.location should be 3. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 40
+FAIL lastKeyboardEvent.location should be 3. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 45
+FAIL lastKeyboardEvent.location should be 3. Was 0.
+PASS lastKeyboardEvent.type is "keydown"
+PASS lastKeyboardEvent.keyCode is 46
+FAIL lastKeyboardEvent.location should be 3. Was 0.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventskeyeventiframeremovedcrashexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/keyevent-iframe-removed-crash-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/keyevent-iframe-removed-crash-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/keyevent-iframe-removed-crash-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+This test passes if it does not crash. Move the mouse out of the window, and then press any key.
+
+PASS
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventskeypressfocuschangeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/keypress-focus-change-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/keypress-focus-change-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/keypress-focus-change-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+This tests that when the keyPress event handler changes focus to a new form field,
+that the key will still be inserted in the original field that was the target of the event.
+
+Test Failed: first field = second field =
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventskeypressinserttabexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/keypress-insert-tab-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/keypress-insert-tab-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/keypress-insert-tab-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+This tests that you can insert a tab in a WebKit app that allows tab insertion
+
+Test Failed
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmouseclickeventsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-click-events-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-click-events-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-click-events-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,17 @@
</span><ins>+This tests what mouse events we send.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Left Mouse Button
+FAIL eventLog should be mousedown(0) mouseup(0) click(0) mousedown(0) mouseup(0) click(0) dblclick(0) . Was mousedown(0) mouseup(0) click(0) mousedown(0) mouseup(0) click(0) .
+Middle Mouse Button
+FAIL eventLog should be mousedown(1) mouseup(1) click(1) mousedown(1) mouseup(1) click(1) dblclick(1) . Was mousedown(0) mouseup(0) click(0) mousedown(0) mouseup(0) click(0) .
+Right Mouse Button
+FAIL eventLog should be mousedown(2) mouseup(2) mousedown(2) mouseup(2) . Was mousedown(0) mouseup(0) click(0) mousedown(0) mouseup(0) click(0) .
+4th Mouse Button
+FAIL eventLog should be mousedown(1) mouseup(1) click(1) mousedown(1) mouseup(1) click(1) dblclick(1) . Was mousedown(0) mouseup(0) click(0) mousedown(0) mouseup(0) click(0) .
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmousecursorchangeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-change-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-change-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-change-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,24 @@
</span><ins>+Test that mouse cursors are changed correctly on mouse events.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Bug 53341
+
+
+Mouse move
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+Mouse down
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+Mouse hold down, move
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+Mouse up
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmousecursorexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,81 @@
</span><ins>+Test that mouse cursors are applied correctly.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Bug 100550
+
+
+TEST CASE: Implicit default cursor
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Explicit default
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Explicit auto
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: No cursor
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Pointer
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: -webkit-grabbing
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Existing 25x25 image
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Invalid URL with fallback to pointer
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Invalid with fallback to 25x25 image
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Image with explicit hot spot at (0,0)
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Image with explicit hot spot at (20,10)
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Image with explicit hot spot at (-1,-1)
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Image with explicit hot spot outside image at (30,30)
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Image with implicit hot spot at (5,4)
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Image with explicit hot spot at (20,10) overriding implicit hot spot
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Image with implicit hot spot outside image at (35,4)
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Over large image with fallback to pointer
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: SVG cursor
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Multiple invalid cursors with fallback to pointer
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Nonexistent SVG cursor with fallback to pointer
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: A link with default cursor
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Link with default cursor overriding wait
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: Wait cursor which should not be affected by unknown cursor rule
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmousecursorimagesetexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-image-set-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-image-set-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-image-set-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,22 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+Test that mouse cursors are applied correctly.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Bug 99493
+
+25x25 image at 1x
+25x25 image at 2x
+25x25 image at 1x, 30x30 image at 2x
+25x25 image at 1.5x, 30x30 image at 5x
+Invalid tiny scale with fallback to pointer
+Over-large image with fallback to pointer
+200x200 image at 4x (not over-large in UI pixels)
+Non-existent image in image-set with fallback to 25x25 image
+Explicit hotspot at (5,3) logical in 1x and 2x
+Explicit hotspot at (7,3) logical in 0.7x and 1.4x - should round to nearest integer
+Implicit hot-spot at (5,4) physical for 1x and (28,3) physical for 2x
+
+FAIL Found the following 0 images, when expecting 6:
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmousecursormultiframecurexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-multiframecur-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-multiframecur-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-multiframecur-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,19 @@
</span><ins>+Test that mouse cursors are applied correctly.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Bug 100059
+
+
+FAIL Got unexpected 'error' event for image: resources/greenbox-3frames.cur
+TEST CASE: Implicit default cursor
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+TEST CASE: CUR file with 3 frames, largest of which (2nd frame) is 20x12 with hotspot at (18,11).
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmousecursornomousemoveexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-no-mousemove-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-no-mousemove-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-cursor-no-mousemove-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,16 @@
</span><ins>+Test that there is no mousemove event fired when changing cursor.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Bug 85343
+
+
+TEST CASE: Mouse idle, change cursor should not fire mousemove event
+Cursor Info: FAIL: Cursor details not available on this platform.
+Cursor Info: FAIL: Cursor details not available on this platform.
+
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmousedragfromframeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-drag-from-frame-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-drag-from-frame-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-drag-from-frame-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+This tests that dragging from an element that returns false from its mousedown handler will not let the subsequent mousemove events be captured by the containing frame.
+
+Drag started
+Unexpected mouseup
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmousedragfromframetootherframeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-drag-from-frame-to-other-frame-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-drag-from-frame-to-other-frame-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouse-drag-from-frame-to-other-frame-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+This tests that dragging from an element that returns false from its mousedown handler will not let the subsequent mousemove events be captured by the containing frame, and allows the mouse move to get to other subframes.
+
+Drag Started
+received mouseup
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmousedowninsubframescrollbarexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mousedown-in-subframe-scrollbar-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mousedown-in-subframe-scrollbar-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mousedown-in-subframe-scrollbar-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+This tests that clicking on a scrollbar in a frame does not clear selections in the frame.
+
+
+Selection:
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmousedowninsidedragstartshouldnotcausecrashexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mousedown-inside-dragstart-should-not-cause-crash-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mousedown-inside-dragstart-should-not-cause-crash-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mousedown-inside-dragstart-should-not-cause-crash-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+This tests pressing a mouse button down inside a dragstart event.
+This happens when a user sets a breakpoint of a dragstart event handler in Inspector, and clicks somewhere on the page while the script is paused at the breakpoint. WebKit should not crash.
+
+FAIL - dragstart was never fired.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmousemoveafterdragoverscrollbarexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mousemove-after-drag-over-scrollbar-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mousemove-after-drag-over-scrollbar-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mousemove-after-drag-over-scrollbar-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+This tests that we continue to get mouse events after dragging past a scrollbar.
+Start a drag in this square, and drag past the scrollbar to the green square. Start a drag in this square, and drag past the scrollbar to the green square.
+
+Test Failed!
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmouseoutonwindowexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouseout-on-window-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouseout-on-window-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouseout-on-window-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+This test ensures that mouse out events are sent to the window.
+FAIL: No mouseout was sent.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmouseoverbuttonexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouseover-button-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouseover-button-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouseover-button-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,13 @@
</span><ins>+Test for bugs cr 87473, 64882.
+
+This test verifies that we get the correct button on mouseover events in .which when entering a document.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+FAIL document.events['A-no-press'].which should be 0. Was 1.
+FAIL document.events['B-left'].which should be 1. Threw exception TypeError: null is not an object (evaluating 'document.events['B-left'].which')
+FAIL document.events['C-no-press'].which should be 0. Threw exception TypeError: null is not an object (evaluating 'document.events['C-no-press'].which')
+FAIL document.events['D-middle'].which should be 2. Threw exception TypeError: null is not an object (evaluating 'document.events['D-middle'].which')
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmouseovermouseout2expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouseover-mouseout2-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouseover-mouseout2-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouseover-mouseout2-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,59 @@
</span><ins>+Tests for bugs 3439, 5764, 7701 - Mouse events vs. DOM manipulation.
+
+Move the mouse pointer from left to right:
+
+3456
+Log Expected results
+mouseover on frame1
+mouseover on t1
+mouseout on t1
+mouseout on frame1
+mouseover on frame2
+mouseover on t2
+mouseout on t2
+mouseout on frame2
+mouseover on frame3
+mouseover on t3_1
+mouseout on frame3
+mouseover on t3_2
+mouseout on t3_2
+mouseover on t4_2
+mouseout on t4_2
+mouseover on frame4
+mouseover on t4_1
+mouseout on t4_1
+mouseout on frame4
+mouseover on frame5
+mouseover on t5_1
+mouseout on frame5
+mouseover on t5_2
+mouseout on t5_2
+mouseover on t6
+mouseout on t6
+mouseover on frame1
+mouseover on t1
+mouseout on t1
+mouseout on frame1
+mouseover on frame2
+mouseover on t2
+mouseout on t2
+mouseout on frame2
+mouseover on frame3
+mouseover on t3_1
+mouseout on t3_1
+mouseout on frame3
+mouseover on t3_2
+mouseout on t3_2
+mouseover on t4_2
+mouseout on t4_2
+mouseover on frame4
+mouseover on t4_1
+mouseout on t4_1
+mouseout on frame4
+mouseover on frame5
+mouseover on t5_1
+mouseout on frame5
+mouseover on t5_2
+mouseout on t5_2
+mouseover on t6
+mouseout on t6
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmouseupfrombutton2expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/mouseup-from-button2-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/mouseup-from-button2-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/mouseup-from-button2-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,17 @@
</span><ins>+This test verifies that a right mousebutton click generates a mousedown, context and mouseup event.
+
+If the test passes, you'll see a PASS message below.
+
+To run this test in Safari:
+
+Right mouse down inside the box.
+Right mouse up.
+box
+
+type: mousedown, button: 0,
+type: mouseup, button: 0,
+type: click, button: 0,
+type: mousedown, button: 0,
+type: mouseup, button: 0,
+type: click, button: 0,
+type: mousedown, button: 0,
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmovingtextshouldfiredropanddragendevents2expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/moving-text-should-fire-drop-and-dragend-events-2-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/moving-text-should-fire-drop-and-dragend-events-2-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/moving-text-should-fire-drop-and-dragend-events-2-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+This tests dragging text within the same contenteditable element. To manually test, move the target below to the destination. You should see source:dragstart, destination:drop, and source:dragend in the log.
+
+Log:
+
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmovingtextshouldfiredropanddragendeventsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/moving-text-should-fire-drop-and-dragend-events-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/moving-text-should-fire-drop-and-dragend-events-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/moving-text-should-fire-drop-and-dragend-events-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+This tests dragging text within the same contenteditable element. To manually test, move the target below to the destination. You should see dragstart, drop, and dragend in the log.
+
+Log:
+
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsmultilinelinkarrownavigationexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/multiline-link-arrow-navigation-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/multiline-link-arrow-navigation-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/multiline-link-arrow-navigation-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+This is a test of links which span multiple lines for various and sundry reasons.
+
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsnobluronpageleaveexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/no-blur-on-page-leave-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/no-blur-on-page-leave-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/no-blur-on-page-leave-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+onblur should not fire if an element has focus when navigating away from the page
+rdar://problem/5326303
+
+blur event fired, FAILED!
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsnoscrolloninputtextselectionexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/no-scroll-on-input-text-selection-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/no-scroll-on-input-text-selection-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/no-scroll-on-input-text-selection-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,21 @@
</span><ins>+Verify selecting text does not cause any scrolling.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+FAIL document.getSelection().toString().length > 1 should be true. Was false.
+PASS pageXOffset is 0
+PASS pageYOffset is originalPageYOffset
+PASS document.body.scrollLeft is 0
+PASS document.body.scrollTop is originalBodyScrollTop
+PASS pageYOffset is document.body.scrollTop
+PASS pageYOffset > 2000 is true
+PASS successfullyParsed is true
+
+TEST COMPLETE
+Test for bug 12331.
+
+To test manually, scroll down until you find the input element. Select some text. If the bug occurs, the page will scroll back up to the top.
+
+
+If the bug does not occur, you'll be left down here at the bottom.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsnodeeventanchorlockexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/node-event-anchor-lock-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/node-event-anchor-lock-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/node-event-anchor-lock-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,7 @@
</span><ins>+This test does the following:
+1. Navigate to an anchor link. WebKit will ensure that the anchor remains visible as other objects load around it and scripts execute.
+2. The div containing the anchor link will be scrolled via PageDown. This simulated user action should stop us locking the screen to where the anchor is.
+3. Force a repaint. If the lock to the anchor was properly released, the scroll caused by the PageDown will not be reverted and parentDiv.scrollTop will be greater than 600px (the offset of the anchor). If we return to the anchor, the test has failed.
+Go to anchor
+FAIL: scrollTop is 600px, but should be more than 600px
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsoffsetXoffsetYexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/offsetX-offsetY-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/offsetX-offsetY-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/offsetX-offsetY-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,21 @@
</span><ins>+CONSOLE MESSAGE: line 124: TypeError: null is not an object (evaluating 'target.dispatchEvent')
+FAIL: Timed out waiting for notifyDone to be called
+Absolute position
+Relative position
+Fixed position
+First Second
+This cell has borderTopExtra
+Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.
+Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat.
+In columns
+Duis aute irure dolor in reprehenderit in voluptate velit esse cillum dolore eu fugiat nulla pariatur. Excepteur sint occaecat cupidatat non proident, sunt in culpa qui officia deserunt mollit anim id est laborum.
+
+Div with transform
+Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat.
+
+In RTL overflow
+Duis aute irure dolor in reprehenderit in voluptate velit esse cillum dolore eu fugiat nulla pariatur. Excepteur sint occaecat cupidatat non proident, sunt in culpa qui officia deserunt mollit anim id est laborum.
+
+PASS: event hit abs-box at offset (32, 37)
+PASS: event hit rel-box at offset (22, 24)
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsonchangerangesliderexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-range-slider-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-range-slider-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-range-slider-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+This test verifies that updating the slider for an input element with type=range fires a change event.
+
+
+FAIL Change event not fired.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsonchangesetvalueexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-setvalue-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-setvalue-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-setvalue-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,14 @@
</span><ins>+FAIL events.length should be 2. Was 0.
+FAIL events[0] should be change e (of type string). Was undefined (of type undefined).
+FAIL events[1] should be change es (of type string). Was undefined (of type undefined).
+FAIL events.length should be 3. Was 0.
+FAIL events[0] should be change a (of type string). Was undefined (of type undefined).
+FAIL events[1] should be change ab (of type string). Was undefined (of type undefined).
+FAIL events[2] should be change abc (of type string). Was undefined (of type undefined).
+FAIL events.length should be 2. Was 0.
+FAIL events[0] should be change e (of type string). Was undefined (of type undefined).
+FAIL events[1] should be change es (of type string). Was undefined (of type undefined).
+FAIL events.length should be 2. Was 0.
+FAIL events[0] should be change e (of type string). Was undefined (of type undefined).
+FAIL events[1] should be change es (of type string). Was undefined (of type undefined).
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsonchangetextformfieldexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-text-form-field-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-text-form-field-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/onchange-text-form-field-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,32 @@
</span><ins>+PASS simulateTextEntry(elements[0], '', BEFORE); is false
+PASS simulateTextEntry(elements[0], 'fo', BEFORE); is true
+FAIL simulateTextEntry(elements[0], 'o'); should be true. Was false.
+FAIL simulateTextEntry(elements[0], 'foo', BEFORE); should be false. Was true.
+FAIL simulateTextEntry(elements[0], 'foo', BEFORE); should be false. Was true.
+FAIL simulateTextEntry(elements[0], ' '); should be true. Was false.
+PASS simulateTextEntry(elements[0], 'foo bar', BEFORE); is true
+FAIL simulateTextEntry(elements[0], 'foo bar', BEFORE); should be false. Was true.
+PASS setTextValue(elements[0], 'foo'); is false
+PASS simulateTextEntry(elements[0], 'foo bar', BEFORE); is true
+FAIL simulateTextEntry(elements[1], '', BEFORE); should be true. Was false.
+FAIL simulateTextEntry(elements[1], 'fo', BEFORE); should be true. Was false.
+FAIL simulateTextEntry(elements[1], 'o'); should be true. Was false.
+FAIL simulateTextEntry(elements[1], 'foo', BEFORE); should be false. Was true.
+FAIL simulateTextEntry(elements[2], 'wee', AFTER); should be false. Was true.
+FAIL simulateTextEntry(elements[2], 'foo', BEFORE | AFTER); should be false. Was true.
+PASS simulateTextEntry(elements[2], 'fo', BEFORE); is true
+FAIL simulateTextEntry(elements[2], 'o'); should be true. Was false.
+FAIL simulateTextEntry(elements[2], 'foo', BEFORE); should be false. Was true.
+FAIL simulateTextEntry(elements[3], 'foo', BEFORE); should be false. Was true.
+FAIL simulateTextEntry(elements[3], 'foo', BEFORE); should be false. Was true.
+PASS setTextValue(elements[3], ''); is false
+FAIL simulateTextEntry(elements[3], 'fo', BEFORE); should be true. Was false.
+FAIL simulateTextEntry(elements[3], 'o'); should be true. Was false.
+FAIL simulateTextEntry(elements[3], 'foo', BEFORE); should be false. Was true.
+FAIL simulateTextEntry(elements[4], 'foo', AFTER); should be false. Was true.
+PASS simulateTextEntry(elements[4], 'foo'); is true
+FAIL simulateTextEntry(elements[4], 'foo', BEFORE); should be false. Was true.
+PASS simulateTextEntry(elements[4], 'foo', BEFORE | AFTER); is true
+PASS simulateTextEntry(elements[4], '', AFTER); is false
+FAIL simulateTextEntry(elements[4], 'foo', AFTER); should be false. Was true.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsondragenterexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/ondragenter-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/ondragenter-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/ondragenter-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+Text
+This automated layout test checks to see that ondragenter events are being sent.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsondroptexthtmlexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/ondrop-text-html-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/ondrop-text-html-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/ondrop-text-html-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+This test verifies that we can get text/html from the drag object during an ondrop event. This test requires DRT.
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsonloadreentryexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/onload-re-entry-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/onload-re-entry-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/onload-re-entry-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+layer at (0,0) size 800x600
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x600
+ RenderBlock {HTML} at (0,0) size 800x600
+ RenderBody {BODY} at (8,8) size 784x576
+ RenderBlock {P} at (0,0) size 784x20
+ RenderText {#text} at (0,0) size 8x19
+ text run at (0,0) width 8: "1"
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsonlyvaliddroptargetsreceivefiledropexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/only-valid-drop-targets-receive-file-drop-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/only-valid-drop-targets-receive-file-drop-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/only-valid-drop-targets-receive-file-drop-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+CONSOLE MESSAGE: line 20: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(['test'])')
+FAIL: Timed out waiting for notifyDone to be called
+To run this test manually, drag a file to one of the two boxes below.
+
+Dropping in drop target 1 should result in a drop event.
+Dropping in drop target 2 should NOT result in a drop event (page will navigate).
+Starting drag...
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsoverflowscrollfakemousemoveexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/overflow-scroll-fake-mouse-move-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/overflow-scroll-fake-mouse-move-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/overflow-scroll-fake-mouse-move-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1 @@
</span><ins>+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventspagescaledmouseclickexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/page-scaled-mouse-click-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/page-scaled-mouse-click-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/page-scaled-mouse-click-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,15 @@
</span><ins>+This tests that page scaling does not affect mouse event pageX and pageY coordinates.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Unscaled
+PASS eventLog is "click(10, 10)"
+
+setPageScale(0.5)
+FAIL eventLog should be click(20, 20). Was click(10, 10).
+
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventspagescaledmouseclickiframeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/page-scaled-mouse-click-iframe-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/page-scaled-mouse-click-iframe-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/page-scaled-mouse-click-iframe-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,22 @@
</span><ins>+
+This tests that page scaling and CSS transforms do not affect mouse event pageX and pageY coordinates for content embedded in an iframe.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Unscaled
+PASS eventLog is "click(10, 10)"
+
+setPageScale(0.5)
+FAIL eventLog should be click(20, 20). Was click(10, 10).
+
+CSS scale(0.5, 2.0)
+PASS eventLog is "click(20, 5)"
+
+setPageScale(0.5), CSS scale(0.5, 2.0)
+FAIL eventLog should be click(40, 10). Was click(20, 5).
+
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventinscrollingdivexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-in-scrolling-div-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-in-scrolling-div-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-in-scrolling-div-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+FAIL div.scrollTop should be 200. Was 0.
+FAIL div.scrollLeft should be 120. Was 0.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxinnonscrollingdivexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-non-scrolling-div-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-non-scrolling-div-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-non-scrolling-div-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+PASS div.scrollTop is window.expectedScrollTop
+PASS div.scrollLeft is window.expectedScrollLeft
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxinnonscrollingpageexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-non-scrolling-page-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-non-scrolling-page-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-non-scrolling-page-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+PASS document.body.scrollTop is window.expectedScrollTop
+PASS document.body.scrollLeft is window.expectedScrollLeft
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxinscrollingdivexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-scrolling-div-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-scrolling-div-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-scrolling-div-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+PASS div.scrollTop is window.expectedScrollTop
+FAIL div.scrollLeft should be 322. Was 0.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxinscrollingpageexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-scrolling-page-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-scrolling-page-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-x-in-scrolling-page-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+PASS document.body.scrollTop is window.expectedScrollTop
+FAIL document.body.scrollLeft should be 700. Was 0.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxyinscrollingdivexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-xy-in-scrolling-div-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-xy-in-scrolling-div-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-xy-in-scrolling-div-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+FAIL div.scrollTop should be 161. Was 0.
+FAIL div.scrollLeft should be 322. Was 0.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingxyinscrollingpageexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-xy-in-scrolling-page-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-xy-in-scrolling-page-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-xy-in-scrolling-page-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+FAIL document.body.scrollTop should be 511. Was 0.
+FAIL document.body.scrollLeft should be 686. Was 0.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingyinnonscrollingdivexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-non-scrolling-div-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-non-scrolling-div-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-non-scrolling-div-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+
+PASS div.scrollTop is window.expectedScrollTop
+PASS div.scrollLeft is window.expectedScrollLeft
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingyinnonscrollingpageexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-non-scrolling-page-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-non-scrolling-page-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-non-scrolling-page-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+PASS document.body.scrollTop is window.expectedScrollTop
+PASS document.body.scrollLeft is window.expectedScrollLeft
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingyinscrollingdivexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-scrolling-div-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-scrolling-div-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-scrolling-div-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+FAIL div.scrollTop should be 322. Was 0.
+PASS div.scrollLeft is window.expectedScrollLeft
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsplatformwheeleventpagingyinscrollingpageexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-scrolling-page-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-scrolling-page-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/platform-wheelevent-paging-y-in-scrolling-page-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+FAIL document.body.scrollTop should be 525. Was 0.
+PASS document.body.scrollLeft is window.expectedScrollLeft
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventspointerevents2expectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/pointer-events-2-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/pointer-events-2-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/pointer-events-2-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,198 @@
</span><ins>+layer at (0,0) size 800x640
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x177
+ RenderBlock {HTML} at (0,0) size 800x177
+ RenderBody {BODY} at (8,21) size 784x140
+ RenderBlock {H1} at (0,0) size 784x38
+ RenderText {#text} at (0,1) size 753x36
+ text run at (0,1) width 753: "Testing the values of 'pointer-events' on HTML content"
+ RenderBlock {P} at (0,59) size 784x81
+ RenderText {#text} at (0,0) size 784x79
+ text run at (0,0) width 589: "This test is expected to be run from within DumpRenderTree. If running manually, click on "
+ text run at (588,0) width 151: "the elements in the first"
+ text run at (0,20) width 389: "column, making sure the actual result (3rd column) matches "
+ text run at (388,20) width 391: "the expected result (2nd column). Repeat for click target (4th"
+ text run at (0,40) width 249: "column), expected result (5th column) "
+ text run at (248,40) width 536: "and actual result (6th column). Note: You should click on a yellow inline element if"
+ text run at (0,60) width 272: "one exists, otherwise anywhere in the box."
+layer at (10,140) size 300x100
+ RenderBlock (positioned) {DIV} at (10,140) size 300x100
+layer at (10,140) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (10,140) size 80x80
+ RenderBlock (positioned) {P} at (0,0) size 80x80 [bgcolor=#808080]
+ RenderText {#text} at (0,0) size 73x39
+ text run at (0,0) width 51: "pointer-"
+ text run at (0,20) width 73: "events auto"
+layer at (110,140) size 80x80
+ RenderBlock (positioned) {DIV} at (100,0) size 80x80
+ RenderText {#text} at (0,0) size 16x19
+ text run at (0,0) width 16: "p1"
+layer at (210,140) size 80x80
+ RenderBlock (positioned) {DIV} at (200,0) size 80x80
+ RenderText {#text} at (0,0) size 16x19
+ text run at (0,0) width 16: "p1"
+layer at (10,240) size 300x100
+ RenderBlock (positioned) {DIV} at (10,240) size 300x100
+layer at (10,240) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (10,240) size 80x80
+ RenderBlock (positioned) {P} at (0,0) size 80x80 [bgcolor=#808080]
+ RenderText {#text} at (0,0) size 76x39
+ text run at (0,0) width 51: "pointer-"
+ text run at (0,20) width 76: "events none"
+layer at (110,240) size 80x80
+ RenderBlock (positioned) {DIV} at (100,0) size 80x80
+ RenderText {#text} at (0,0) size 32x19
+ text run at (0,0) width 32: "none"
+layer at (210,240) size 80x80
+ RenderBlock (positioned) {DIV} at (200,0) size 80x80
+ RenderText {#text} at (0,0) size 32x19
+ text run at (0,0) width 32: "none"
+layer at (10,340) size 300x100
+ RenderBlock (positioned) {DIV} at (10,340) size 300x100
+layer at (10,340) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (10,340) size 80x80
+ RenderBlock (positioned) {P} at (0,0) size 80x80 [bgcolor=#808080]
+ RenderText {#text} at (0,0) size 72x39
+ text run at (0,0) width 60: "siblings -"
+ text run at (0,20) width 72: "auto on top"
+layer at (10,340) size 80x80
+ RenderBlock (positioned) {P} at (0,0) size 80x80
+layer at (110,340) size 80x80
+ RenderBlock (positioned) {DIV} at (100,0) size 80x80
+ RenderText {#text} at (0,0) size 16x19
+ text run at (0,0) width 16: "p4"
+layer at (210,340) size 80x80
+ RenderBlock (positioned) {DIV} at (200,0) size 80x80
+ RenderText {#text} at (0,0) size 16x19
+ text run at (0,0) width 16: "p4"
+layer at (10,440) size 300x100
+ RenderBlock (positioned) {DIV} at (10,440) size 300x100
+layer at (10,440) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (10,440) size 80x80
+ RenderBlock (positioned) {P} at (0,0) size 80x80 [bgcolor=#808080]
+ RenderText {#text} at (0,0) size 76x39
+ text run at (0,0) width 60: "siblings -"
+ text run at (0,20) width 76: "none on top"
+layer at (10,440) size 80x80
+ RenderBlock (positioned) {P} at (0,0) size 80x80
+layer at (110,440) size 80x80
+ RenderBlock (positioned) {DIV} at (100,0) size 80x80
+ RenderText {#text} at (0,0) size 16x19
+ text run at (0,0) width 16: "p5"
+layer at (210,440) size 80x80
+ RenderBlock (positioned) {DIV} at (200,0) size 80x80
+ RenderText {#text} at (0,0) size 16x19
+ text run at (0,0) width 16: "p5"
+layer at (10,540) size 300x100
+ RenderBlock (positioned) {DIV} at (10,540) size 300x100
+layer at (10,540) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (10,540) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (10,540) size 80x80
+ RenderBlock (positioned) {P} at (0,0) size 80x80 [bgcolor=#808080]
+ RenderText {#text} at (0,0) size 65x39
+ text run at (0,0) width 51: "nested -"
+ text run at (0,20) width 65: "auto outer"
+layer at (110,540) size 80x80
+ RenderBlock (positioned) {DIV} at (100,0) size 80x80
+ RenderText {#text} at (0,0) size 16x19
+ text run at (0,0) width 16: "p7"
+layer at (210,540) size 80x80
+ RenderBlock (positioned) {DIV} at (200,0) size 80x80
+ RenderText {#text} at (0,0) size 16x19
+ text run at (0,0) width 16: "p7"
+layer at (340,140) size 300x100
+ RenderBlock (positioned) {DIV} at (340,140) size 300x100
+layer at (340,140) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (340,140) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (340,140) size 80x80
+ RenderBlock (positioned) {P} at (0,0) size 80x80 [bgcolor=#808080]
+ RenderText {#text} at (0,0) size 68x39
+ text run at (0,0) width 51: "nested -"
+ text run at (0,20) width 68: "none outer"
+layer at (440,140) size 80x80
+ RenderBlock (positioned) {DIV} at (100,0) size 80x80
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "p10"
+layer at (540,140) size 80x80
+ RenderBlock (positioned) {DIV} at (200,0) size 80x80
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "p10"
+layer at (340,240) size 300x100
+ RenderBlock (positioned) {DIV} at (340,240) size 300x100
+layer at (340,240) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (340,240) size 80x80
+ RenderImage {IMG} at (0,0) size 80x80
+layer at (440,240) size 80x80
+ RenderBlock (positioned) {DIV} at (100,0) size 80x80
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "p11"
+layer at (540,240) size 80x80
+ RenderBlock (positioned) {DIV} at (200,0) size 80x80
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "p11"
+layer at (340,340) size 300x100
+ RenderBlock (positioned) {DIV} at (340,340) size 300x100
+layer at (340,340) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (340,340) size 80x80
+ RenderImage {IMG} at (0,0) size 80x80
+layer at (440,340) size 80x80
+ RenderBlock (positioned) {DIV} at (100,0) size 80x80
+ RenderText {#text} at (0,0) size 32x19
+ text run at (0,0) width 32: "none"
+layer at (540,340) size 80x80
+ RenderBlock (positioned) {DIV} at (200,0) size 80x80
+ RenderText {#text} at (0,0) size 32x19
+ text run at (0,0) width 32: "none"
+layer at (340,440) size 300x100
+ RenderBlock (positioned) {DIV} at (340,440) size 300x100
+layer at (340,440) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (340,440) size 80x80
+ RenderBlock (positioned) {P} at (0,0) size 80x80 [bgcolor=#808080]
+ RenderInline {SPAN} at (0,0) size 37x19 [bgcolor=#FFFF00]
+ RenderText {#text} at (0,0) size 37x19
+ text run at (0,0) width 37: "inline"
+ RenderText {#text} at (36,0) size 76x59
+ text run at (36,0) width 26: " has"
+ text run at (0,20) width 76: "auto, parent"
+ text run at (0,40) width 32: "none"
+layer at (440,440) size 80x80
+ RenderBlock (positioned) {DIV} at (100,0) size 80x80
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "p14"
+layer at (540,440) size 80x80
+ RenderBlock (positioned) {DIV} at (200,0) size 80x80
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "p14"
+layer at (340,540) size 300x100
+ RenderBlock (positioned) {DIV} at (340,540) size 300x100
+layer at (340,540) size 80x80
+ RenderBlock (positioned) {DIV} at (0,0) size 80x80
+layer at (340,540) size 80x80
+ RenderBlock (positioned) {P} at (0,0) size 80x80 [bgcolor=#808080]
+ RenderInline {SPAN} at (0,0) size 37x19 [bgcolor=#FFFF00]
+ RenderText {#text} at (0,0) size 37x19
+ text run at (0,0) width 37: "inline"
+ RenderText {#text} at (36,0) size 80x59
+ text run at (36,0) width 26: " has"
+ text run at (0,20) width 80: "none, parent"
+ text run at (0,40) width 28: "auto"
+layer at (440,540) size 80x80
+ RenderBlock (positioned) {DIV} at (100,0) size 80x80
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "p15"
+layer at (540,540) size 80x80
+ RenderBlock (positioned) {DIV} at (200,0) size 80x80
+ RenderText {#text} at (0,0) size 24x19
+ text run at (0,0) width 24: "p15"
+caret: position 1 of child 0 {#text} of child 0 {SPAN} of child 1 {P} of child 1 {DIV} of child 23 {DIV} of body
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventspreventdragtonavigateexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/prevent-drag-to-navigate-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/prevent-drag-to-navigate-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/prevent-drag-to-navigate-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+CONSOLE MESSAGE: line 33: TypeError: undefined is not a function (evaluating 'eventSender.beginDragWithFiles(["resources/file-for-prevent-drag-to-navigate.html"])')
+FAIL: Timed out waiting for notifyDone to be called
+PASS
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsrecordedkeydowneventexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/recorded-keydown-event-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/recorded-keydown-event-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/recorded-keydown-event-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+Test for bug 37718: Crash when replaying a sequence of keyboard events.
+
+
+Please press any key.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsremovechildonscrollexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/remove-child-onscroll-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/remove-child-onscroll-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/remove-child-onscroll-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+This test verifies that children can be removed by their parent element's onscroll event handler. The test succeeds if this is the only text remaining after the two scroll events are dispatched. The test fails if the inner div remains in the output or if WebKit crashes.
+
+Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat. Duis aute irure dolor in reprehenderit in voluptate velit esse cillum dolore eu fugiat nulla pariatur. Excepteur sint occaecat cupidatat non proident, sunt in culpa qui officia deserunt mollit anim id est laborum
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsremovetargetwithshadowindragexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/remove-target-with-shadow-in-drag-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/remove-target-with-shadow-in-drag-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/remove-target-with-shadow-in-drag-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1 @@
</span><ins>+PASS. DRT didn't crash.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsresizeeventsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/resize-events-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/resize-events-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/resize-events-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,33 @@
</span><ins>+layer at (0,0) size 800x4256
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x4256
+ RenderBlock {HTML} at (0,0) size 800x4256
+ RenderBody {BODY} at (8,8) size 784x4238
+ RenderBlock {DIV} at (0,0) size 784x112
+ RenderBlock (anonymous) at (0,0) size 784x40
+ RenderText {#text} at (0,0) size 749x39
+ text run at (0,0) width 588: "Test how many resize events are emitted during page load and dynamic content generation. "
+ text run at (587,0) width 162: "Do not resize the page. It"
+ text run at (0,20) width 124: "invalidates the test."
+ RenderBlock {P} at (0,56) size 784x56
+ RenderBlock (anonymous) at (0,0) size 784x20
+ RenderText {#text} at (10,0) size 185x19
+ text run at (10,0) width 185: "Resize events (should be 0): "
+ RenderInline {SPAN} at (0,0) size 9x19
+ RenderText {#text} at (194,0) size 9x19
+ text run at (194,0) width 9: "0"
+ RenderText {#text} at (0,0) size 0x0
+ RenderBlock {P} at (0,36) size 784x20 [color=#008000]
+ RenderText {#text} at (10,0) size 37x19
+ text run at (10,0) width 37: "PASS"
+ RenderBlock {DIV} at (0,128) size 784x4110
+ RenderBlock {DIV} at (10,0) size 764x402 [border: (1px solid #000000)]
+ RenderBlock {DIV} at (10,412) size 764x402 [border: (1px solid #000000)]
+ RenderBlock {DIV} at (10,824) size 764x402 [border: (1px solid #000000)]
+ RenderBlock {DIV} at (10,1236) size 764x402 [border: (1px solid #000000)]
+ RenderBlock {DIV} at (10,1648) size 764x402 [border: (1px solid #000000)]
+ RenderBlock {DIV} at (10,2060) size 764x402 [border: (1px solid #000000)]
+ RenderBlock {DIV} at (10,2472) size 764x402 [border: (1px solid #000000)]
+ RenderBlock {DIV} at (10,2884) size 764x402 [border: (1px solid #000000)]
+ RenderBlock {DIV} at (10,3296) size 764x402 [border: (1px solid #000000)]
+ RenderBlock {DIV} at (10,3708) size 764x402 [border: (1px solid #000000)]
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsresizesubframeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/resize-subframe-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/resize-subframe-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/resize-subframe-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsreveallinkwhenfocusedexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/reveal-link-when-focused-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/reveal-link-when-focused-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/reveal-link-when-focused-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,14 @@
</span><ins>+layer at (0,0) size 800x2036
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x2036
+ RenderBlock {HTML} at (0,0) size 800x2036
+ RenderBody {BODY} at (8,8) size 784x2020
+ RenderBlock {DIV} at (0,0) size 784x2000
+ RenderText {#text} at (0,0) size 340x19
+ text run at (0,0) width 340: "padding to make link be initially scrolled out of sight"
+ RenderBlock (anonymous) at (0,2000) size 784x20
+ RenderInline {A} at (0,0) size 363x19 [color=#551A8B]
+ RenderText {#text} at (0,0) size 363x19
+ text run at (0,0) width 363: "this link should be focused and revealed after page loads"
+ RenderText {#text} at (0,0) size 0x0
+scrolled to 0,1436
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsrightclickfocusexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/right-click-focus-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/right-click-focus-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/right-click-focus-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+Test that right-clicking on a text area properly focuses it.
+
+
+FAIL: No text in textarea
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsscaleandscrollbodyexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-body-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-body-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-body-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,7 @@
</span><ins>+FAIL window.document.body.scrollTop should be 30. Was 0.
+FAIL window.document.body.scrollLeft should be 30. Was 0.
+PASS window.document.body.scrollTop is 100
+FAIL window.document.body.scrollLeft should be 100. Was 0.
+FAIL window.scrollX should be 100. Was 0.
+PASS window.scrollY is 100
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsscaleandscrolliframebodyexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-iframe-body-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-iframe-body-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-iframe-body-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,6 @@
</span><ins>+
+FAIL frame.contentDocument.body.scrollTop should be 100. Was 0.
+PASS frame.contentDocument.body.scrollLeft is 100
+PASS frame.contentWindow.scrollX is 100
+FAIL frame.contentWindow.scrollY should be 100. Was 0.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsscaleandscrolliframewindowexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-iframe-window-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-iframe-window-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-iframe-window-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+FAIL frame.contentDocument.body.scrollTop should be 100. Was 0.
+FAIL frame.contentDocument.body.scrollLeft should be 100. Was 0.
+FAIL frame.contentWindow.scrollX should be 100. Was 0.
+FAIL frame.contentWindow.scrollY should be 100. Was 0.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsscaleandscrollwindowexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-window-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-window-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/scale-and-scroll-window-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+FAIL window.document.body.scrollTop should be 100. Was 0.
+FAIL window.document.body.scrollLeft should be 100. Was 0.
+FAIL window.scrollX should be 100. Was 0.
+FAIL window.scrollY should be 100. Was 0.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsscopededitingcommandsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/scoped/editing-commands-expected.txt ( => )</h4>
<pre class="diff"><span>
<span class="info">Added: trunk/LayoutTests/platform/ios-simulator/fast/events/scroll-after-click-on-tab-index-expected.txt
===================================================================
</span><del>--- trunk/LayoutTests/platform/ios-simulator/fast/events/scroll-after-click-on-tab-index-expected.txt (rev 0)
</del><ins>+++ trunk/LayoutTests/platform/ios-simulator/fast/events/scroll-after-click-on-tab-index-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</ins><span class="lines">@@ -0,0 +1,44 @@
</span><ins>+ALERT: Scroll position 0
+Click the text below and then try to scroll.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+Scroll position is more than 0
+FAIL document.body.scrollTop > 0 should be true. Was false.
+
+
+
+
+
+
+
+
+
+
+My span
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsscrollinscaledpagewithoverflowhiddenexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/scroll-in-scaled-page-with-overflow-hidden-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/scroll-in-scaled-page-with-overflow-hidden-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/scroll-in-scaled-page-with-overflow-hidden-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+This tests that a usually overflow: hidden viewport should be scrollable when scaled. Otherwise, you can't get to content you would have been able to get to had you not been zoomed it.
+PASS window.document.body.scrollTop is 0
+FAIL window.document.body.scrollTop should be 100. Was 0.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsscrollbardoubleclickexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/scrollbar-double-click-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/scrollbar-double-click-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/scrollbar-double-click-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1 @@
</span><ins>+Scroll offset is 0
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsselectelementexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/select-element-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/select-element-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/select-element-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,118 @@
</span><ins>+This test verifies that the Home/End/PageUp/PageDown keys work correctly for <select> elements. Since it requires eventSender.keyDown, it will not run solo in the web browser; it must be run with run-webkit-tests.
+
+
+PASS sendKeyAndExpectIndex("ss", "pageDown", 0, 3) is true
+PASS sendKeyAndExpectIndex("ss", "pageDown", 1, 4) is true
+PASS sendKeyAndExpectIndex("ss", "pageDown", 2, 5) is true
+PASS sendKeyAndExpectIndex("ss", "pageDown", 3, 6) is true
+PASS sendKeyAndExpectIndex("ss", "pageDown", 4, 6) is true
+PASS sendKeyAndExpectIndex("ss", "pageDown", 5, 6) is true
+PASS sendKeyAndExpectIndex("ss", "pageDown", 6, 6) is true
+PASS sendKeyAndExpectIndex("ss", "pageUp", 6, 3) is true
+PASS sendKeyAndExpectIndex("ss", "pageUp", 5, 2) is true
+PASS sendKeyAndExpectIndex("ss", "pageUp", 4, 1) is true
+PASS sendKeyAndExpectIndex("ss", "pageUp", 3, 0) is true
+PASS sendKeyAndExpectIndex("ss", "pageUp", 2, 0) is true
+PASS sendKeyAndExpectIndex("ss", "pageUp", 1, 0) is true
+PASS sendKeyAndExpectIndex("ss", "pageUp", 0, 0) is true
+PASS sendKeyAndExpectIndex("ss", "home", 6, 0) is true
+PASS sendKeyAndExpectIndex("ss", "home", 5, 0) is true
+PASS sendKeyAndExpectIndex("ss", "home", 4, 0) is true
+PASS sendKeyAndExpectIndex("ss", "home", 3, 0) is true
+PASS sendKeyAndExpectIndex("ss", "home", 2, 0) is true
+PASS sendKeyAndExpectIndex("ss", "home", 1, 0) is true
+PASS sendKeyAndExpectIndex("ss", "home", 0, 0) is true
+PASS sendKeyAndExpectIndex("ss", "end", 6, 6) is true
+PASS sendKeyAndExpectIndex("ss", "end", 5, 6) is true
+PASS sendKeyAndExpectIndex("ss", "end", 4, 6) is true
+PASS sendKeyAndExpectIndex("ss", "end", 3, 6) is true
+PASS sendKeyAndExpectIndex("ss", "end", 2, 6) is true
+PASS sendKeyAndExpectIndex("ss", "end", 1, 6) is true
+PASS sendKeyAndExpectIndex("ss", "end", 0, 6) is true
+PASS sendKeyAndExpectIndex("ssd", "pageDown", 0, 4) is true
+PASS sendKeyAndExpectIndex("ssd", "pageDown", 1, 4) is true
+PASS sendKeyAndExpectIndex("ssd", "pageDown", 2, 5) is true
+PASS sendKeyAndExpectIndex("ssd", "pageDown", 4, 6) is true
+PASS sendKeyAndExpectIndex("ssd", "pageDown", 5, 6) is true
+PASS sendKeyAndExpectIndex("ssd", "pageDown", 6, 6) is true
+FAIL sendKeyAndExpectIndex("ssd", "pageDown", 7, 6) should be true. Was false.
+PASS sendKeyAndExpectIndex("ssd", "pageUp", 7, 4) is true
+PASS sendKeyAndExpectIndex("ssd", "pageUp", 6, 2) is true
+PASS sendKeyAndExpectIndex("ssd", "pageUp", 5, 2) is true
+PASS sendKeyAndExpectIndex("ssd", "pageUp", 4, 1) is true
+PASS sendKeyAndExpectIndex("ssd", "pageUp", 2, 1) is true
+PASS sendKeyAndExpectIndex("ssd", "pageUp", 1, 1) is true
+FAIL sendKeyAndExpectIndex("ssd", "pageUp", 0, 1) should be true. Was false.
+PASS sendKeyAndExpectIndex("ssd", "home", 7, 1) is true
+PASS sendKeyAndExpectIndex("ssd", "home", 6, 1) is true
+PASS sendKeyAndExpectIndex("ssd", "home", 5, 1) is true
+PASS sendKeyAndExpectIndex("ssd", "home", 4, 1) is true
+PASS sendKeyAndExpectIndex("ssd", "home", 3, 1) is true
+PASS sendKeyAndExpectIndex("ssd", "home", 2, 1) is true
+PASS sendKeyAndExpectIndex("ssd", "home", 1, 1) is true
+PASS sendKeyAndExpectIndex("ssd", "home", 0, 1) is true
+PASS sendKeyAndExpectIndex("ssd", "end", 7, 6) is true
+PASS sendKeyAndExpectIndex("ssd", "end", 6, 6) is true
+PASS sendKeyAndExpectIndex("ssd", "end", 5, 6) is true
+PASS sendKeyAndExpectIndex("ssd", "end", 4, 6) is true
+PASS sendKeyAndExpectIndex("ssd", "end", 3, 6) is true
+PASS sendKeyAndExpectIndex("ssd", "end", 2, 6) is true
+PASS sendKeyAndExpectIndex("ssd", "end", 1, 6) is true
+PASS sendKeyAndExpectIndex("ssd", "end", 0, 6) is true
+FAIL sendWithShiftKeyAndExpectIndices("ss", "pageDown", [0, 1, 2, 3]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "pageDown", [0, 1, 2, 3, 4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "pageDown", [0, 1, 2, 3, 4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "pageUp", [0, 1, 2, 3]) should be true. Was false.
+PASS sendWithShiftKeyAndExpectIndices("ss", "pageUp", [0]) is true
+PASS sendWithShiftKeyAndExpectIndices("ss", "pageUp", [0]) is true
+FAIL sendWithShiftKeyAndExpectIndices("ss", "end", [0, 1, 2, 3, 4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "end", [0, 1, 2, 3, 4, 5, 6]) should be true. Was false.
+PASS sendWithShiftKeyAndExpectIndices("ss", "home", [0]) is true
+PASS sendWithShiftKeyAndExpectIndices("ss", "home", [0]) is true
+FAIL sendWithShiftKeyAndExpectIndices("ss", "pageDown", [3, 4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "pageDown", [3, 4, 5, 6]) should be true. Was false.
+PASS sendWithShiftKeyAndExpectIndices("ss", "pageUp", [3]) is true
+FAIL sendWithShiftKeyAndExpectIndices("ss", "pageUp", [0, 1, 2, 3]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "pageUp", [0, 1, 2, 3]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "pageUp", [0, 1, 2, 3]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "end", [3, 4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "end", [3, 4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "home", [0, 1, 2, 3]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ss", "home", [0, 1, 2, 3]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "pageDown", [1, 2, 4]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "pageDown", [1, 2, 4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "pageDown", [1, 2, 4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "pageUp", [1, 2]) should be true. Was false.
+PASS sendWithShiftKeyAndExpectIndices("ssd", "pageUp", [1]) is true
+PASS sendWithShiftKeyAndExpectIndices("ssd", "pageUp", [1]) is true
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "end", [1, 2, 4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "end", [1, 2, 4, 5, 6]) should be true. Was false.
+PASS sendWithShiftKeyAndExpectIndices("ssd", "home", [1]) is true
+PASS sendWithShiftKeyAndExpectIndices("ssd", "home", [1]) is true
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "pageDown", [4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "pageDown", [4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "pageUp", [2, 4]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "pageUp", [1, 2, 4]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "pageUp", [1, 2, 4]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "end", [4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "end", [4, 5, 6]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "home", [1, 2, 4]) should be true. Was false.
+FAIL sendWithShiftKeyAndExpectIndices("ssd", "home", [1, 2, 4]) should be true. Was false.
+PASS sendKeyAndExpectIndex("ssg", "pageDown", 0, 3) is true
+PASS sendKeyAndExpectIndex("ssg", "pageDown", 1, 3) is true
+PASS sendKeyAndExpectIndex("ssg", "pageDown", 2, 4) is true
+PASS sendKeyAndExpectIndex("ssg", "pageDown", 3, 5) is true
+PASS sendKeyAndExpectIndex("ssg", "pageDown", 4, 6) is true
+PASS sendKeyAndExpectIndex("ssg", "pageDown", 5, 6) is true
+PASS sendKeyAndExpectIndex("ssg", "pageDown", 6, 6) is true
+PASS sendKeyAndExpectIndex("ssg", "pageUp", 6, 4) is true
+PASS sendKeyAndExpectIndex("ssg", "pageUp", 5, 3) is true
+PASS sendKeyAndExpectIndex("ssg", "pageUp", 4, 2) is true
+PASS sendKeyAndExpectIndex("ssg", "pageUp", 3, 1) is true
+PASS sendKeyAndExpectIndex("ssg", "pageUp", 2, 0) is true
+PASS sendKeyAndExpectIndex("ssg", "pageUp", 1, 0) is true
+PASS sendKeyAndExpectIndex("ssg", "pageUp", 0, 0) is true
+PASS successfullyParsed is true
+
+TEST COMPLETE
+selectedIndex should be 6 (is 7) after a pageDown from index 7 selectedIndex should be 1 (is 0) after a pageUp from index 0 selected indices should be [0, 1, 2, 3] (is [3]) after a pageDown selected indices should be [0, 1, 2, 3, 4, 5, 6] (is [6]) after a pageDown selected indices should be [0, 1, 2, 3, 4, 5, 6] (is [6]) after a pageDown selected indices should be [0, 1, 2, 3] (is [3]) after a pageUp selected indices should be [0, 1, 2, 3, 4, 5, 6] (is [6]) after a end selected indices should be [0, 1, 2, 3, 4, 5, 6] (is [6]) after a end selected indices should be [3, 4, 5, 6] (is [6]) after a pageDown selected indices should be [3, 4, 5, 6] (is [6]) after a pageDown selected indices should be [0, 1, 2, 3] (is [0]) after a pageUp selected indices should be [0, 1, 2, 3] (is [0]) after a pageUp selected indices should be [0, 1, 2, 3] (is [0]) after a pageUp selected indices should be [3, 4, 5, 6] (is [6]) after a end selected indices should be [3, 4, 5, 6] (is [6]) after a end selected indices should be [0, 1, 2, 3] (is [0]) after a home selected indices should be [0, 1, 2, 3] (is [0]) after a home selected indices should be [1, 2, 4] (is [4]) after a pageDown selected indices should be [1, 2, 4, 5, 6] (is [6]) after a pageDown selected indices should be [1, 2, 4, 5, 6] (is [6]) after a pageDown selected indices should be [1, 2] (is [2]) after a pageUp selected indices should be [1, 2, 4, 5, 6] (is [6]) after a end selected indices should be [1, 2, 4, 5, 6] (is [6]) after a end selected indices should be [4, 5, 6] (is [6]) after a pageDown selected indices should be [4, 5, 6] (is [6]) after a pageDown selected indices should be [2, 4] (is [2]) after a pageUp selected indices should be [1, 2, 4] (is [1]) after a pageUp selected indices should be [1, 2, 4] (is [1]) after a pageUp selected indices should be [4, 5, 6] (is [6]) after a end selected indices should be [4, 5, 6] (is [6]) after a end selected indices should be [1, 2, 4] (is [1]) after a home selected indices should be [1, 2, 4] (is [1]) after a home
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsselectionchangeuserinitiatedexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/selectionchange-user-initiated-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/selectionchange-user-initiated-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/selectionchange-user-initiated-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,25 @@
</span><ins>+To test this manually, click on "hello", and extend selection to right by pressing right arrow keys with shift twice. Then click again on "world" and extend selection twice the same way.
+
+hello
+world
+PASS: mousedown
+PASS: selectionchange
+PASS: mouseup
+PASS: click
+PASS: keydown
+PASS: keyup
+FAIL: keydown but expected selectionchange
+FAIL: keyup but expected keydown
+FAIL: mousedown but expected keyup
+PASS: selectionchange
+FAIL: selectionchange but expected mousedown
+FAIL: mouseup but expected selectionchange
+OPTIONAL: selectionchange
+FAIL: click but expected mouseup
+FAIL: keydown but expected click
+FAIL: keyup but expected keydown
+FAIL: keydown but expected keyup
+FAIL: keyup but expected selectionchange
+EXPECT: keydown
+EXPECT: keyup
+EXPECT: selectionchange
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsselectstartbyarrowkeysexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-arrow-keys-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-arrow-keys-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-arrow-keys-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,18 @@
</span><ins>+This test ensures selectstart is fired when selection is created by arrow keys.
+
+If running this test manually, click on div ("Hello World") element and try to select the text using arrow keys.
+Expected result : SelectStart event will fire when user starts extending selection.
+Hello World
+Initial state: PASS
+Check (Right arrow): PASS
+Check (Right arrow + Shift): FAIL - expected 1 events but got 0 events
+Check (Right arrow + Shift + Control): FAIL - expected 1 events but got 0 events
+Check (End + Shift): FAIL - expected 1 events but got 0 events
+Check (Home + Shift): FAIL - expected 1 events but got 0 events
+Check (End + Shift): FAIL - expected 1 events but got 0 events
+Check (Left arrow): FAIL - expected 1 events but got 0 events
+Check (LeftArrow + Shift + Control): FAIL - expected 2 events but got 0 events
+Check (Left arrow + Shift): FAIL - expected 2 events but got 0 events
+Check (Home + Shift): FAIL - expected 2 events but got 0 events
+Check (Home + Control): FAIL - expected 2 events but got 0 events
+Done.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsselectstartbyarrowkeyspreventdefaultexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-arrow-keys-prevent-default-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-arrow-keys-prevent-default-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-arrow-keys-prevent-default-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,9 @@
</span><ins>+This test ensures selectstart event fires when selection is created by arrow key and script can prevent the selection change.
+
+If running this test manually, click on the div ("Hello World") and try to select the text using arrow keys.
+Expected result: SelectStart event will fire when user starts extending the selection, but due to script preventDefault it prevents the selection change.
+Hello World
+Check Right arrow + Shift: FAIL - expected 1 events but got 0 events
+Check Right arrow + Shift + Control: FAIL - expected 2 events but got 0 events
+Check End + Shift: FAIL - expected 3 events but got 0 events
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsselectstartbydoubletripleclicksexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-double-triple-clicks-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-double-triple-clicks-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-double-triple-clicks-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,11 @@
</span><ins>+This test ensures selectstart is fired exactly once when selecting text by a mouse drag.
+
+Initial state: PASS
+Mouse down: PASS
+Mouse up: PASS
+Second mouse down: FAIL - expected selection to be range but was caret
+Second mouse up: FAIL - expected selection to be range but was caret
+Third mouse down: FAIL - expected selection to be range but was caret
+Third mouse up: FAIL - expected selection to be range but was caret
+Done.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsselectstartbydragexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-drag-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-drag-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-drag-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,14 @@
</span><ins>+This test ensures selectstart is fired exactly once when selecting text by a mouse drag.
+
+Initial state: PASS
+Mouse down: PASS
+Moving slightly to the right: PASS
+Moving slightly to the left: PASS
+Moving to the right: FAIL - expected selection to be range but was caret
+Moving further to the right: FAIL - expected selection to be range but was caret
+Moving back to the left: PASS
+Moving to the right again: FAIL - expected selection to be range but was caret
+Mouse down on the right: PASS
+Moving to the left: FAIL - expected selection to be range but was caret
+Done.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsselectstartbysingleclickwithshiftexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-single-click-with-shift-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-single-click-with-shift-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-by-single-click-with-shift-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+This test ensures selectstart is fired exactly once when selecting text by a mouse drag.
+
+Initial state: PASS
+Mouse down: PASS
+Mouse up: PASS
+Moving to the right: PASS
+Second mouse down: FAIL - expected selection to be range but was caret
+Second mouse up: FAIL - expected selection to be range but was caret
+Done.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsselectstartpreventselectallexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-prevent-selectall-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-prevent-selectall-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-prevent-selectall-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,16 @@
</span><ins>+EDITING DELEGATE: shouldBeginEditingInDOMRange:range from 0 of DIV > SECTION > BODY > HTML > #document to 1 of DIV > SECTION > BODY > HTML > #document
+EDITING DELEGATE: shouldChangeSelectedDOMRange:(null) toDOMRange:range from 0 of DIV > SECTION > BODY > HTML > #document to 0 of DIV > SECTION > BODY > HTML > #document affinity:NSSelectionAffinityDownstream stillSelecting:FALSE
+EDITING DELEGATE: webViewDidBeginEditing:WebViewDidBeginEditingNotification
+EDITING DELEGATE: webViewDidChangeSelection:WebViewDidChangeSelectionNotification
+EDITING DELEGATE: webViewDidChangeSelection:WebViewDidChangeSelectionNotification
+EDITING DELEGATE: shouldEndEditingInDOMRange:range from 0 of DIV > SECTION > BODY > HTML > #document to 1 of DIV > SECTION > BODY > HTML > #document
+EDITING DELEGATE: webViewDidChangeSelection:WebViewDidChangeSelectionNotification
+EDITING DELEGATE: webViewDidEndEditing:WebViewDidEndEditingNotification
+EDITING DELEGATE: webViewDidChangeSelection:WebViewDidChangeSelectionNotification
+EDITING DELEGATE: webViewDidChangeSelection:WebViewDidChangeSelectionNotification
+EDITING DELEGATE: webViewDidChangeSelection:WebViewDidChangeSelectionNotification
+This test ensures selectstart event fires when selecting all and script can prevent the selection change.
+
+div: PASS
+input: PASS
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsselectstartpreventselectiononrightclickexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-prevent-selection-on-right-click-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-prevent-selection-on-right-click-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/selectstart-prevent-selection-on-right-click-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,4 @@
</span><ins>+EDITING DELEGATE: webViewDidChangeSelection:WebViewDidChangeSelectionNotification
+This test ensures selectstart event fires when selecting a word by right click and script can prevent the selection change.
+
+FAIL - handler was never called
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsshadoweventpathexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/shadow-event-path-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/shadow-event-path-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/shadow-event-path-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,306 @@
</span><ins>+This test records target and relatedTarget at each element while dispatching a mouse click event at an input element.
+
+
+Content:<div id="detailsContainer"><details><summary><div id="divInsideSummary"><input id="target" type="text" size="10"></div></summary></details></div>
+
+mouseover@input#target
+ target:input#target
+ relatedTarget:null
+
+mouseover@div#divInsideSummary
+ target:input#target
+ relatedTarget:null
+
+mouseover@summary
+ target:input#target
+ relatedTarget:null
+
+mouseover@details
+ target:input#target
+ relatedTarget:null
+
+mouseover@div#detailsContainer
+ target:input#target
+ relatedTarget:null
+
+mouseover@body
+ target:input#target
+ relatedTarget:null
+
+mouseover@html
+ target:input#target
+ relatedTarget:null
+
+mouseover@document
+ target:input#target
+ relatedTarget:null
+
+mouseover@window
+ target:input#target
+ relatedTarget:null
+
+mouseenter@input#target
+ target:input#target
+ relatedTarget:null
+
+mouseenter@div#divInsideSummary
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mouseenter@summary
+ target:summary
+ relatedTarget:null
+
+mouseenter@details
+ target:details
+ relatedTarget:null
+
+mouseenter@div#detailsContainer
+ target:div#detailsContainer
+ relatedTarget:null
+
+mouseenter@body
+ target:body
+ relatedTarget:null
+
+mouseenter@html
+ target:html
+ relatedTarget:null
+
+mousemove@input#target
+ target:input#target
+ relatedTarget:null
+
+mousemove@div#divInsideSummary
+ target:input#target
+ relatedTarget:null
+
+mousemove@summary
+ target:input#target
+ relatedTarget:null
+
+mousemove@details
+ target:input#target
+ relatedTarget:null
+
+mousemove@div#detailsContainer
+ target:input#target
+ relatedTarget:null
+
+mousemove@body
+ target:input#target
+ relatedTarget:null
+
+mousemove@html
+ target:input#target
+ relatedTarget:null
+
+mousemove@document
+ target:input#target
+ relatedTarget:null
+
+mousemove@window
+ target:input#target
+ relatedTarget:null
+
+mouseout@input#target
+ target:input#target
+ relatedTarget:div#divInsideSummary
+
+mouseout@div#divInsideSummary
+ target:input#target
+ relatedTarget:div#divInsideSummary
+
+mouseout@summary
+ target:input#target
+ relatedTarget:div#divInsideSummary
+
+mouseout@details
+ target:input#target
+ relatedTarget:div#divInsideSummary
+
+mouseout@div#detailsContainer
+ target:input#target
+ relatedTarget:div#divInsideSummary
+
+mouseout@body
+ target:input#target
+ relatedTarget:div#divInsideSummary
+
+mouseout@html
+ target:input#target
+ relatedTarget:div#divInsideSummary
+
+mouseout@document
+ target:input#target
+ relatedTarget:div#divInsideSummary
+
+mouseout@window
+ target:input#target
+ relatedTarget:div#divInsideSummary
+
+mouseleave@input#target
+ target:input#target
+ relatedTarget:div#divInsideSummary
+
+mouseover@div#divInsideSummary
+ target:div#divInsideSummary
+ relatedTarget:input#target
+
+mouseover@summary
+ target:div#divInsideSummary
+ relatedTarget:input#target
+
+mouseover@details
+ target:div#divInsideSummary
+ relatedTarget:input#target
+
+mouseover@div#detailsContainer
+ target:div#divInsideSummary
+ relatedTarget:input#target
+
+mouseover@body
+ target:div#divInsideSummary
+ relatedTarget:input#target
+
+mouseover@html
+ target:div#divInsideSummary
+ relatedTarget:input#target
+
+mouseover@document
+ target:div#divInsideSummary
+ relatedTarget:input#target
+
+mouseover@window
+ target:div#divInsideSummary
+ relatedTarget:input#target
+
+mousemove@div#divInsideSummary
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousemove@summary
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousemove@details
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousemove@div#detailsContainer
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousemove@body
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousemove@html
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousemove@document
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousemove@window
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousedown@div#divInsideSummary
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousedown@summary
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousedown@details
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousedown@div#detailsContainer
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousedown@body
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousedown@html
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousedown@document
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mousedown@window
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mouseup@div#divInsideSummary
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mouseup@summary
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mouseup@details
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mouseup@div#detailsContainer
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mouseup@body
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mouseup@html
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mouseup@document
+ target:div#divInsideSummary
+ relatedTarget:null
+
+mouseup@window
+ target:div#divInsideSummary
+ relatedTarget:null
+
+click@div#divInsideSummary
+ target:div#divInsideSummary
+ relatedTarget:null
+
+click@summary
+ target:div#divInsideSummary
+ relatedTarget:null
+
+click@details
+ target:div#divInsideSummary
+ relatedTarget:null
+
+click@div#detailsContainer
+ target:div#divInsideSummary
+ relatedTarget:null
+
+click@body
+ target:div#divInsideSummary
+ relatedTarget:null
+
+click@html
+ target:div#divInsideSummary
+ relatedTarget:null
+
+click@document
+ target:div#divInsideSummary
+ relatedTarget:null
+
+click@window
+ target:div#divInsideSummary
+ relatedTarget:null
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsshowmodaldialogonbluronfocusexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/show-modal-dialog-onblur-onfocus-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/show-modal-dialog-onblur-onfocus-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/show-modal-dialog-onblur-onfocus-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+Pop up a modal dialog. Verifies that focus events are not fired while inside the message loop.
+
+
+You need to disable pop-up blocker for this test to run successfully in the browser.
+
+onblur fired. Should see this exactly once.
+ERROR: onfocus fired.
+Modal dialog closing.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsspecialkeyeventsininputtextexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/special-key-events-in-input-text-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/special-key-events-in-input-text-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/special-key-events-in-input-text-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,49 @@
</span><ins>+This test verifies that the correct sequence of keyboard events is generated for a keypress for certain special keys. To test manually, press keys and compare results to other browsers.
+
+
+target - type - ctrlKey,altKey,shiftKey,metaKey - keyIdentifier - keyCode - charCode
+
+Ampersand:
+INPUT - keydown - false,false,true,false - U+0037 - 55 - 0. Value: "".
+INPUT - keypress - false,false,true,false - - 55 - 55. Value: "".
+INPUT - keyup - false,false,true,false - U+0037 - 55 - 0. Value: "".
+
+Backspace:
+INPUT - keydown - false,false,false,false - U+0008 - 8 - 0. Value: "".
+INPUT - textInput - 7. Value: "".
+INPUT - keyup - false,false,false,false - U+0008 - 8 - 0. Value: "7".
+
+Percent:
+INPUT - keydown - false,false,true,false - U+0035 - 53 - 0. Value: "7".
+INPUT - keypress - false,false,true,false - - 53 - 53. Value: "7".
+INPUT - keyup - false,false,true,false - U+0035 - 53 - 0. Value: "".
+
+Backspace:
+INPUT - keydown - false,false,false,false - U+0008 - 8 - 0. Value: "".
+INPUT - keyup - false,false,false,false - U+0008 - 8 - 0. Value: "".
+
+Left parenthesis:
+INPUT - keydown - false,false,true,false - U+0039 - 57 - 0. Value: "".
+INPUT - keypress - false,false,true,false - - 57 - 57. Value: "".
+INPUT - textInput - 5. Value: "".
+INPUT - textInput - 9. Value: "".
+INPUT - keyup - false,false,true,false - U+0039 - 57 - 0. Value: "9".
+
+Backspace:
+INPUT - keydown - false,false,false,false - U+0008 - 8 - 0. Value: "9".
+INPUT - keyup - false,false,false,false - U+0008 - 8 - 0. Value: "9".
+
+Right parenthesis:
+INPUT - keydown - false,false,true,false - U+0030 - 48 - 0. Value: "9".
+INPUT - keypress - false,false,true,false - - 48 - 48. Value: "9".
+INPUT - keyup - false,false,true,false - U+0030 - 48 - 0. Value: "".
+
+Backspace:
+INPUT - keydown - false,false,false,false - U+0008 - 8 - 0. Value: "".
+INPUT - keyup - false,false,false,false - U+0008 - 8 - 0. Value: "".
+
+Print screen:
+INPUT - keydown - false,false,false,false - PrintScreen - 44 - 0. Value: "".
+INPUT - keyup - false,false,false,false - PrintScreen - 44 - 0. Value: "".
+INPUT - textInput - 0. Value: "".
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsstandaloneimagedragtoeditableexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/standalone-image-drag-to-editable-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/standalone-image-drag-to-editable-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/standalone-image-drag-to-editable-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,28 @@
</span><ins>+CONSOLE MESSAGE: line 12: TypeError: undefined is not an object (evaluating 'img.width')
+FAIL: Timed out waiting for notifyDone to be called
+layer at (0,0) size 800x600
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x600
+ RenderBlock {HTML} at (0,0) size 800x600
+ RenderFrameSet {FRAMESET} at (0,0) size 800x600
+ RenderFrame {FRAME} at (0,0) size 800x100
+ layer at (0,0) size 800x102
+ RenderView at (0,0) size 800x100
+ layer at (0,0) size 800x102
+ RenderBlock {HTML} at (0,0) size 800x102
+ RenderBody {BODY} at (0,0) size 800x102
+ RenderBlock {DIV} at (0,0) size 800x102 [border: (1px solid #000000)]
+ RenderText {#text} at (1,1) size 702x19
+ text run at (1,1) width 702: "This layout test is checks that we don't crash when a stand alone image is dragged into a content editable div. "
+ RenderBR {BR} at (702,16) size 1x0
+ RenderInline {A} at (0,0) size 153x19 [color=#0000EE]
+ RenderText {#text} at (1,21) size 153x19
+ text run at (1,21) width 153: "rdar://problem/5021127"
+ RenderText {#text} at (0,0) size 0x0
+ RenderFrame {FRAME} at (0,106) size 800x100
+ layer at (0,0) size 800x100
+ RenderView at (0,0) size 800x100
+ layer at (0,0) size 800x100
+ RenderBlock {HTML} at (0,0) size 800x100
+ RenderBody {BODY} at (0,0) size 800x100
+ RenderImage {IMG} at (0,0) size 25x25
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstabfocuslinkincanvasexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/tab-focus-link-in-canvas-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/tab-focus-link-in-canvas-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/tab-focus-link-in-canvas-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,11 @@
</span><ins>+Ensures that you can tab to focus a link inside a canvas subtree.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS document.activeElement.id is "before"
+FAIL document.activeElement.id should be canvas_link. Was .
+PASS successfullyParsed is true
+
+TEST COMPLETE
+Before
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstabindexfocusblurallexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/tabindex-focus-blur-all-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/tabindex-focus-blur-all-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/tabindex-focus-blur-all-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,440 @@
</span><ins>+335 focus / 335 blur events dispatched, and should be 333 / 333 PASSED
+Total of 2 focus test(s) failed.
+Details:
+<A> a1 PASSED focus test
+<MAP> map1 PASSED focus test
+<AREA> area1a PASSED focus test
+<AREA> area1b PASSED focus test
+<DIV> div1a PASSED focus test
+<AUDIO> audio1 PASSED focus test
+<VIDEO> video1 PASSED focus test
+<SOURCE> source1 PASSED focus test
+<APPLET> applet1 PASSED focus test
+object1 FAILED - was focused but focus wasn't expected
+elemThatShouldFocus is null, focusedElem is <OBJECT> object1
+<EMBED> embed1 PASSED focus test
+<DIV> div1b PASSED focus test
+<ABBR> abbr1 PASSED focus test
+<ACRONYM> acronym1 PASSED focus test
+<BDO> bdo1 PASSED focus test
+<BLOCKQUOTE> blockquote1 PASSED focus test
+<Q> q1 PASSED focus test
+<P> p1 PASSED focus test
+<BR> br1 PASSED focus test
+<HR> hr1 PASSED focus test
+<MARQUEE> marquee1 PASSED focus test
+<CENTER> center1 PASSED focus test
+<B> b1 PASSED focus test
+<BIG> big1 PASSED focus test
+<I> i1 PASSED focus test
+<SMALL> small1 PASSED focus test
+<TT> tt1 PASSED focus test
+<DIV> div1c PASSED focus test
+<CANVAS> canvas1 PASSED focus test
+<EM> em1 PASSED focus test
+<STRONG> strong1 PASSED focus test
+<DFN> dfn1 PASSED focus test
+<CODE> code1 PASSED focus test
+<SAMP> samp1 PASSED focus test
+<KBD> kbd1 PASSED focus test
+<VAR> var1 PASSED focus test
+<CITE> cite1 PASSED focus test
+<DIV> div1d PASSED focus test
+<H1> h1_1 PASSED focus test
+<H2> h2_1 PASSED focus test
+<H3> h3_1 PASSED focus test
+<H4> h4_1 PASSED focus test
+<H5> h5_1 PASSED focus test
+<H6> h6_1 PASSED focus test
+<S> s1 PASSED focus test
+<STRIKE> strike1 PASSED focus test
+<SUB> sub1 PASSED focus test
+<SUP> sup1 PASSED focus test
+<U> u1 PASSED focus test
+<DEL> del1 PASSED focus test
+<INS> ins1 PASSED focus test
+<PRE> pre1 PASSED focus test
+<FONT> font1 PASSED focus test
+<SPAN> span1 PASSED focus test
+<DIV> div1e PASSED focus test
+<TABLE> table1 PASSED focus test
+<CAPTION> caption1 PASSED focus test
+<COLGROUP> colgroup1 PASSED focus test
+<COL> col1a PASSED focus test
+<COL> col1b PASSED focus test
+<THEAD> thead1 PASSED focus test
+<TH> th1 PASSED focus test
+<TBODY> tbody1 PASSED focus test
+<TR> tr1 PASSED focus test
+<TD> td1a PASSED focus test
+<TD> td1b PASSED focus test
+<TD> td1c PASSED focus test
+<TFOOT> tfoot1 PASSED focus test
+<DL> dl1 PASSED focus test
+<DT> dt1a PASSED focus test
+<DD> dd1a PASSED focus test
+<DT> dt1b PASSED focus test
+<DD> dd1b PASSED focus test
+<DIV> div1f PASSED focus test
+<UL> ul1 PASSED focus test
+<LI> li1a PASSED focus test
+<OL> ol1 PASSED focus test
+<LI> li1b PASSED focus test
+<MENU> menu1 PASSED focus test
+<LI> li1c PASSED focus test
+<DIR> dir1 PASSED focus test
+<LI> li1d PASSED focus test
+<IMG> image1 PASSED focus test
+<IMG> img1 PASSED focus test
+<DIV> div1g PASSED focus test
+<FORM> form1 PASSED focus test
+<FIELDSET> fieldset1 PASSED focus test
+<LEGEND> legend1 PASSED focus test
+<SELECT> select1 PASSED focus test
+<OPTGROUP> optgroup1 PASSED focus test
+<OPTION> option1a PASSED focus test
+<OPTION> option1b PASSED focus test
+<TEXTAREA> textarea1 PASSED focus test
+<INPUT> text1 PASSED focus test
+<INPUT> checkbox1 PASSED focus test
+<INPUT> radioChoice1a PASSED focus test
+<LABEL> label1 PASSED focus test
+<INPUT> file1 PASSED focus test
+<INPUT> hidden1 PASSED focus test
+<INPUT> inputImage1 PASSED focus test
+<BUTTON> button1 PASSED focus test
+<INPUT> inputButton1 PASSED focus test
+<INPUT> search1 PASSED focus test
+<INPUT> password1 PASSED focus test
+<INPUT> range1 PASSED focus test
+<INPUT> submit1 PASSED focus test
+<INPUT> reset1 PASSED focus test
+<IFRAME> iframe1a PASSED focus test
+<A> a2 PASSED focus test
+<MAP> map2 PASSED focus test
+<AREA> area2a PASSED focus test
+<AREA> area2b PASSED focus test
+<DIV> div2a PASSED focus test
+<AUDIO> audio2 PASSED focus test
+<VIDEO> video2 PASSED focus test
+<SOURCE> source2 PASSED focus test
+<APPLET> applet2 PASSED focus test
+<OBJECT> object2 PASSED focus test
+<EMBED> embed2 PASSED focus test
+<DIV> div2b PASSED focus test
+<ABBR> abbr2 PASSED focus test
+<ACRONYM> acronym2 PASSED focus test
+<BDO> bdo2 PASSED focus test
+<BLOCKQUOTE> blockquote2 PASSED focus test
+<Q> q2 PASSED focus test
+<P> p2 PASSED focus test
+<BR> br2 PASSED focus test
+<HR> hr2 PASSED focus test
+<MARQUEE> marquee2 PASSED focus test
+<CENTER> center2 PASSED focus test
+<B> b2 PASSED focus test
+<BIG> big2 PASSED focus test
+<I> i2 PASSED focus test
+<SMALL> small2 PASSED focus test
+<TT> tt2 PASSED focus test
+<DIV> div2c PASSED focus test
+<CANVAS> canvas2 PASSED focus test
+<EM> em2 PASSED focus test
+<STRONG> strong2 PASSED focus test
+<DFN> dfn2 PASSED focus test
+<CODE> code2 PASSED focus test
+<SAMP> samp2 PASSED focus test
+<KBD> kbd2 PASSED focus test
+<VAR> var2 PASSED focus test
+<CITE> cite2 PASSED focus test
+<DIV> div2d PASSED focus test
+<H1> h1_2 PASSED focus test
+<H2> h2_2 PASSED focus test
+<H3> h3_2 PASSED focus test
+<H4> h4_2 PASSED focus test
+<H5> h5_2 PASSED focus test
+<H6> h6_2 PASSED focus test
+<S> s2 PASSED focus test
+<STRIKE> strike2 PASSED focus test
+<SUB> sub2 PASSED focus test
+<SUP> sup2 PASSED focus test
+<U> u2 PASSED focus test
+<DEL> del2 PASSED focus test
+<INS> ins2 PASSED focus test
+<PRE> pre2 PASSED focus test
+<FONT> font2 PASSED focus test
+<SPAN> span2 PASSED focus test
+<DIV> div2e PASSED focus test
+<TABLE> table2 PASSED focus test
+<CAPTION> caption2 PASSED focus test
+<COLGROUP> colgroup2 PASSED focus test
+<COL> col2a PASSED focus test
+<COL> col2b PASSED focus test
+<THEAD> thead2 PASSED focus test
+<TH> th2 PASSED focus test
+<TBODY> tbody2 PASSED focus test
+<TR> tr2 PASSED focus test
+<TD> td2a PASSED focus test
+<TD> td2b PASSED focus test
+<TD> td2c PASSED focus test
+<TFOOT> tfoot2 PASSED focus test
+<DL> dl2 PASSED focus test
+<DT> dt2a PASSED focus test
+<DD> dd2a PASSED focus test
+<DT> dt2b PASSED focus test
+<DD> dd2b PASSED focus test
+<DIV> div2f PASSED focus test
+<UL> ul2 PASSED focus test
+<LI> li2a PASSED focus test
+<OL> ol2 PASSED focus test
+<LI> li2b PASSED focus test
+<MENU> menu2 PASSED focus test
+<LI> li2c PASSED focus test
+<DIR> dir2 PASSED focus test
+<LI> li2d PASSED focus test
+<IMG> image2 PASSED focus test
+<IMG> img2 PASSED focus test
+<DIV> div2g PASSED focus test
+<FORM> form2 PASSED focus test
+<FIELDSET> fieldset2 PASSED focus test
+<LEGEND> legend2 PASSED focus test
+<SELECT> select2 PASSED focus test
+<OPTGROUP> optgroup2 PASSED focus test
+<OPTION> option2a PASSED focus test
+<OPTION> option2b PASSED focus test
+<TEXTAREA> textarea2 PASSED focus test
+<INPUT> text2 PASSED focus test
+<INPUT> checkbox2 PASSED focus test
+<INPUT> radioChoice2a PASSED focus test
+<LABEL> label2 PASSED focus test
+<INPUT> file2 PASSED focus test
+<INPUT> hidden2 PASSED focus test
+<INPUT> inputImage2 PASSED focus test
+<BUTTON> button2 PASSED focus test
+<INPUT> inputButton2 PASSED focus test
+<INPUT> search2 PASSED focus test
+<INPUT> password2 PASSED focus test
+<INPUT> range2 PASSED focus test
+<INPUT> submit2 PASSED focus test
+<INPUT> reset2 PASSED focus test
+<IFRAME> iframe1b PASSED focus test
+<DIV> theConsole PASSED focus test
+<A> a3 PASSED focus test
+<MAP> map3 PASSED focus test
+<AREA> area3a PASSED focus test
+<AREA> area3b PASSED focus test
+<DIV> div3a PASSED focus test
+<AUDIO> audio3 PASSED focus test
+<VIDEO> video3 PASSED focus test
+<SOURCE> source3 PASSED focus test
+<APPLET> applet3 PASSED focus test
+<OBJECT> object3 PASSED focus test
+<EMBED> embed3 PASSED focus test
+<DIV> div3b PASSED focus test
+<ABBR> abbr3 PASSED focus test
+<ACRONYM> acronym3 PASSED focus test
+<BDO> bdo3 PASSED focus test
+<BLOCKQUOTE> blockquote3 PASSED focus test
+<Q> q3 PASSED focus test
+<P> p3 PASSED focus test
+<BR> br3 PASSED focus test
+<HR> hr3 PASSED focus test
+<MARQUEE> marquee3 PASSED focus test
+<CENTER> center3 PASSED focus test
+<B> b3 PASSED focus test
+<BIG> big3 PASSED focus test
+<I> i3 PASSED focus test
+<SMALL> small3 PASSED focus test
+<TT> tt3 PASSED focus test
+<DIV> div3c PASSED focus test
+<CANVAS> canvas3 PASSED focus test
+<EM> em3 PASSED focus test
+<STRONG> strong3 PASSED focus test
+<DFN> dfn3 PASSED focus test
+<CODE> code3 PASSED focus test
+<SAMP> samp3 PASSED focus test
+<KBD> kbd3 PASSED focus test
+<VAR> var3 PASSED focus test
+<CITE> cite3 PASSED focus test
+<DIV> div3d PASSED focus test
+<H1> h1_3 PASSED focus test
+<H2> h2_3 PASSED focus test
+<H3> h3_3 PASSED focus test
+<H4> h4_3 PASSED focus test
+<H5> h5_3 PASSED focus test
+<H6> h6_3 PASSED focus test
+<S> s3 PASSED focus test
+<STRIKE> strike3 PASSED focus test
+<SUB> sub3 PASSED focus test
+<SUP> sup3 PASSED focus test
+<U> u3 PASSED focus test
+<DEL> del3 PASSED focus test
+<INS> ins3 PASSED focus test
+<PRE> pre3 PASSED focus test
+<FONT> font3 PASSED focus test
+<SPAN> span3 PASSED focus test
+<DIV> div3e PASSED focus test
+<TABLE> table3 PASSED focus test
+<CAPTION> caption3 PASSED focus test
+<COLGROUP> colgroup3 PASSED focus test
+<COL> col3a PASSED focus test
+<COL> col3b PASSED focus test
+<THEAD> thead3 PASSED focus test
+<TH> th3 PASSED focus test
+<TBODY> tbody3 PASSED focus test
+<TR> tr3 PASSED focus test
+<TD> td3a PASSED focus test
+<TD> td3b PASSED focus test
+<TD> td3c PASSED focus test
+<TFOOT> tfoot3 PASSED focus test
+<DL> dl3 PASSED focus test
+<DT> dt3a PASSED focus test
+<DD> dd3a PASSED focus test
+<DT> dt3b PASSED focus test
+<DD> dd3b PASSED focus test
+<DIV> div3f PASSED focus test
+<UL> ul3 PASSED focus test
+<LI> li3a PASSED focus test
+<OL> ol3 PASSED focus test
+<LI> li3b PASSED focus test
+<MENU> menu3 PASSED focus test
+<LI> li3c PASSED focus test
+<DIR> dir3 PASSED focus test
+<LI> li3d PASSED focus test
+<IMG> image3 PASSED focus test
+<IMG> img3 PASSED focus test
+<DIV> div3g PASSED focus test
+<FORM> form3 PASSED focus test
+<FIELDSET> fieldset3 PASSED focus test
+<LEGEND> legend3 PASSED focus test
+<SELECT> select3 PASSED focus test
+<OPTGROUP> optgroup3 PASSED focus test
+<OPTION> option3a PASSED focus test
+<OPTION> option3b PASSED focus test
+<TEXTAREA> textarea3 PASSED focus test
+<INPUT> text3 PASSED focus test
+<INPUT> checkbox3 PASSED focus test
+<INPUT> radioChoice3a PASSED focus test
+<LABEL> label3 PASSED focus test
+<INPUT> file3 PASSED focus test
+<INPUT> hidden3 PASSED focus test
+<INPUT> inputImage3 PASSED focus test
+<BUTTON> button3 PASSED focus test
+<INPUT> inputButton3 PASSED focus test
+<INPUT> search3 PASSED focus test
+<INPUT> password3 PASSED focus test
+<INPUT> range3 PASSED focus test
+<INPUT> submit3 PASSED focus test
+<INPUT> reset3 PASSED focus test
+<IFRAME> iframe2a PASSED focus test
+<A> a4 PASSED focus test
+<MAP> map4 PASSED focus test
+<AREA> area4a PASSED focus test
+<AREA> area4b PASSED focus test
+<DIV> div4a PASSED focus test
+<AUDIO> audio4 PASSED focus test
+<VIDEO> video4 PASSED focus test
+<SOURCE> source4 PASSED focus test
+<APPLET> applet4 PASSED focus test
+<OBJECT> object4 PASSED focus test
+embed4 FAILED - was focused but focus wasn't expected
+elemThatShouldFocus is null, focusedElem is <EMBED> embed4
+<DIV> div4b PASSED focus test
+<ABBR> abbr4 PASSED focus test
+<ACRONYM> acronym4 PASSED focus test
+<BDO> bdo4 PASSED focus test
+<BLOCKQUOTE> blockquote4 PASSED focus test
+<Q> q4 PASSED focus test
+<P> p4 PASSED focus test
+<BR> br4 PASSED focus test
+<HR> hr4 PASSED focus test
+<MARQUEE> marquee4 PASSED focus test
+<CENTER> center4 PASSED focus test
+<B> b4 PASSED focus test
+<BIG> big4 PASSED focus test
+<I> i4 PASSED focus test
+<SMALL> small4 PASSED focus test
+<TT> tt4 PASSED focus test
+<DIV> div4c PASSED focus test
+<CANVAS> canvas4 PASSED focus test
+<EM> em4 PASSED focus test
+<STRONG> strong4 PASSED focus test
+<DFN> dfn4 PASSED focus test
+<CODE> code4 PASSED focus test
+<SAMP> samp4 PASSED focus test
+<KBD> kbd4 PASSED focus test
+<VAR> var4 PASSED focus test
+<CITE> cite4 PASSED focus test
+<DIV> div4d PASSED focus test
+<H1> h1_4 PASSED focus test
+<H2> h2_4 PASSED focus test
+<H3> h3_4 PASSED focus test
+<H4> h4_4 PASSED focus test
+<H5> h5_4 PASSED focus test
+<H6> h6_4 PASSED focus test
+<S> s4 PASSED focus test
+<STRIKE> strike4 PASSED focus test
+<SUB> sub4 PASSED focus test
+<SUP> sup4 PASSED focus test
+<U> u4 PASSED focus test
+<DEL> del4 PASSED focus test
+<INS> inst4 PASSED focus test
+<PRE> pre4 PASSED focus test
+<FONT> font4 PASSED focus test
+<SPAN> span4 PASSED focus test
+<DIV> div4e PASSED focus test
+<TABLE> table4 PASSED focus test
+<CAPTION> caption4 PASSED focus test
+<COLGROUP> colgroup4 PASSED focus test
+<COL> col4a PASSED focus test
+<COL> col4b PASSED focus test
+<THEAD> thead4 PASSED focus test
+<TH> th4 PASSED focus test
+<TBODY> tbody4 PASSED focus test
+<TR> tr4a PASSED focus test
+<TD> td4a PASSED focus test
+<TD> tr4b PASSED focus test
+<TD> td4b PASSED focus test
+<TFOOT> tfoot4 PASSED focus test
+<DL> dl4 PASSED focus test
+<DT> dt4a PASSED focus test
+<DD> dd4a PASSED focus test
+<DT> dt4b PASSED focus test
+<DD> dd4b PASSED focus test
+<DIV> div4f PASSED focus test
+<UL> ul4 PASSED focus test
+<LI> li4a PASSED focus test
+<OL> ol4 PASSED focus test
+<LI> li4b PASSED focus test
+<MENU> menu4 PASSED focus test
+<LI> li4c PASSED focus test
+<DIR> dir4 PASSED focus test
+<LI> li4d PASSED focus test
+<IMG> image4 PASSED focus test
+<IMG> img4 PASSED focus test
+<DIV> div4g PASSED focus test
+<FORM> form4 PASSED focus test
+<FIELDSET> fieldset4 PASSED focus test
+<LEGEND> legend4 PASSED focus test
+<SELECT> select4 PASSED focus test
+<OPTGROUP> optgroup4 PASSED focus test
+<OPTION> option4a PASSED focus test
+<OPTION> option4b PASSED focus test
+<TEXTAREA> textarea4 PASSED focus test
+<INPUT> text4 PASSED focus test
+<INPUT> checkbox4 PASSED focus test
+<INPUT> radioChoice4a PASSED focus test
+<LABEL> label4 PASSED focus test
+<INPUT> file4 PASSED focus test
+<INPUT> hidden4 PASSED focus test
+<INPUT> inputImage4 PASSED focus test
+<BUTTON> button4 PASSED focus test
+<INPUT> inputButton4 PASSED focus test
+<INPUT> search4 PASSED focus test
+<INPUT> password4 PASSED focus test
+<INPUT> range4 PASSED focus test
+<INPUT> submit4 PASSED focus test
+<INPUT> reset4 PASSED focus test
+<IFRAME> iframe2b PASSED focus test
+<DIV> theConsole PASSED focus test
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchbasicmultitoucheventsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-multi-touch-events-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-multi-touch-events-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-multi-touch-events-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,103 @@
</span><ins>+This tests basic multi touch event support.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+multi touch sequence
+Two touchpoints pressed
+PASS lastEvent.type is "touchstart"
+PASS lastEvent.touches.length is 2
+PASS lastEvent.changedTouches.length is 2
+PASS lastEvent.targetTouches.length is 2
+FAIL lastEvent.pageX should be 0. Was 15.
+FAIL lastEvent.pageY should be 0. Was 20.
+PASS lastEvent.touches[0].pageX is 10
+PASS lastEvent.touches[0].pageY is 10
+PASS lastEvent.touches[0].clientX is 10
+PASS lastEvent.touches[0].clientY is 10
+PASS lastEvent.touches[0].identifier is 0
+PASS lastEvent.touches[1].pageX is 20
+PASS lastEvent.touches[1].pageY is 30
+PASS lastEvent.touches[1].clientX is 20
+PASS lastEvent.touches[1].clientY is 30
+PASS lastEvent.touches[1].identifier is 1
+PASS lastEvent.changedTouches[0].pageX is 10
+PASS lastEvent.changedTouches[0].pageY is 10
+PASS lastEvent.changedTouches[0].clientX is 10
+PASS lastEvent.changedTouches[0].clientY is 10
+PASS lastEvent.changedTouches[0].identifier is 0
+PASS lastEvent.changedTouches[1].pageX is 20
+PASS lastEvent.changedTouches[1].pageY is 30
+PASS lastEvent.changedTouches[1].clientX is 20
+PASS lastEvent.changedTouches[1].clientY is 30
+PASS lastEvent.changedTouches[1].identifier is 1
+PASS lastEvent.targetTouches[0].pageX is 10
+PASS lastEvent.targetTouches[0].pageY is 10
+PASS lastEvent.targetTouches[0].clientX is 10
+PASS lastEvent.targetTouches[0].clientY is 10
+PASS lastEvent.targetTouches[0].identifier is 0
+PASS lastEvent.targetTouches[1].pageX is 20
+PASS lastEvent.targetTouches[1].pageY is 30
+PASS lastEvent.targetTouches[1].clientX is 20
+PASS lastEvent.targetTouches[1].clientY is 30
+PASS lastEvent.targetTouches[1].identifier is 1
+First touchpoint moved
+PASS lastEvent.type is "touchmove"
+PASS lastEvent.touches.length is 2
+PASS lastEvent.changedTouches.length is 1
+PASS lastEvent.targetTouches.length is 2
+FAIL lastEvent.pageX should be 0. Was 17.
+FAIL lastEvent.pageY should be 0. Was 22.
+PASS lastEvent.touches[0].pageX is 15
+PASS lastEvent.touches[0].pageY is 15
+PASS lastEvent.touches[0].clientX is 15
+PASS lastEvent.touches[0].clientY is 15
+PASS lastEvent.touches[0].identifier is 0
+PASS lastEvent.changedTouches[0].pageX is 15
+PASS lastEvent.changedTouches[0].pageY is 15
+PASS lastEvent.changedTouches[0].clientX is 15
+PASS lastEvent.changedTouches[0].clientY is 15
+PASS lastEvent.changedTouches[0].identifier is 0
+PASS lastEvent.touches[1].pageX is 20
+PASS lastEvent.touches[1].pageY is 30
+PASS lastEvent.touches[1].clientX is 20
+PASS lastEvent.touches[1].clientY is 30
+PASS lastEvent.touches[1].identifier is 1
+First touchpoint is released
+PASS lastEvent.type is "touchend"
+PASS lastEvent.touches.length is 1
+PASS lastEvent.changedTouches.length is 1
+PASS lastEvent.targetTouches.length is 1
+FAIL lastEvent.pageX should be 0. Was 20.
+FAIL lastEvent.pageY should be 0. Was 30.
+PASS lastEvent.touches[0].pageX is 20
+PASS lastEvent.touches[0].pageY is 30
+PASS lastEvent.touches[0].clientX is 20
+PASS lastEvent.touches[0].clientY is 30
+PASS lastEvent.touches[0].identifier is 1
+PASS lastEvent.changedTouches[0].pageX is 15
+PASS lastEvent.changedTouches[0].pageY is 15
+PASS lastEvent.changedTouches[0].clientX is 15
+PASS lastEvent.changedTouches[0].clientY is 15
+PASS lastEvent.changedTouches[0].identifier is 0
+PASS lastEvent.targetTouches[0].pageX is 20
+PASS lastEvent.targetTouches[0].pageY is 30
+PASS lastEvent.targetTouches[0].clientX is 20
+PASS lastEvent.targetTouches[0].clientY is 30
+PASS lastEvent.targetTouches[0].identifier is 1
+Last remaining touchpoint is released
+PASS lastEvent.type is "touchend"
+PASS lastEvent.touches.length is 0
+PASS lastEvent.changedTouches.length is 1
+PASS lastEvent.targetTouches.length is 0
+PASS lastEvent.pageX is 0
+PASS lastEvent.pageY is 0
+PASS lastEvent.changedTouches[0].pageX is 20
+PASS lastEvent.changedTouches[0].pageY is 30
+PASS lastEvent.changedTouches[0].clientX is 20
+PASS lastEvent.changedTouches[0].clientY is 30
+PASS lastEvent.changedTouches[0].identifier is 1
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchbasicmultitoucheventslimitedexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-multi-touch-events-limited-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-multi-touch-events-limited-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-multi-touch-events-limited-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,97 @@
</span><ins>+This tests basic multi touch event support. This is a limited version of test basic-multi-touch-events.html that avoids the situation where one touch point is released while another is maintained.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS lastEvent.type is "touchstart"
+PASS lastEvent.touches.length is 2
+PASS lastEvent.changedTouches.length is 2
+PASS lastEvent.targetTouches.length is 2
+FAIL lastEvent.pageX should be 0. Was 15.
+FAIL lastEvent.pageY should be 0. Was 20.
+PASS lastEvent.touches[0].pageX is 10
+PASS lastEvent.touches[0].pageY is 10
+PASS lastEvent.touches[0].clientX is 10
+PASS lastEvent.touches[0].clientY is 10
+PASS lastEvent.touches[0].identifier is 0
+PASS lastEvent.touches[1].pageX is 20
+PASS lastEvent.touches[1].pageY is 30
+PASS lastEvent.touches[1].clientX is 20
+PASS lastEvent.touches[1].clientY is 30
+PASS lastEvent.touches[1].identifier is 1
+PASS lastEvent.changedTouches[0].pageX is 10
+PASS lastEvent.changedTouches[0].pageY is 10
+PASS lastEvent.changedTouches[0].clientX is 10
+PASS lastEvent.changedTouches[0].clientY is 10
+PASS lastEvent.changedTouches[0].identifier is 0
+PASS lastEvent.changedTouches[1].pageX is 20
+PASS lastEvent.changedTouches[1].pageY is 30
+PASS lastEvent.changedTouches[1].clientX is 20
+PASS lastEvent.changedTouches[1].clientY is 30
+PASS lastEvent.changedTouches[1].identifier is 1
+PASS lastEvent.targetTouches[0].pageX is 10
+PASS lastEvent.targetTouches[0].pageY is 10
+PASS lastEvent.targetTouches[0].clientX is 10
+PASS lastEvent.targetTouches[0].clientY is 10
+PASS lastEvent.targetTouches[0].identifier is 0
+PASS lastEvent.targetTouches[1].pageX is 20
+PASS lastEvent.targetTouches[1].pageY is 30
+PASS lastEvent.targetTouches[1].clientX is 20
+PASS lastEvent.targetTouches[1].clientY is 30
+PASS lastEvent.targetTouches[1].identifier is 1
+PASS lastEvent.type is "touchmove"
+PASS lastEvent.touches.length is 2
+PASS lastEvent.changedTouches.length is 2
+PASS lastEvent.targetTouches.length is 2
+FAIL lastEvent.pageX should be 0. Was 20.
+FAIL lastEvent.pageY should be 0. Was 25.
+PASS lastEvent.touches[0].pageX is 15
+PASS lastEvent.touches[0].pageY is 15
+PASS lastEvent.touches[0].clientX is 15
+PASS lastEvent.touches[0].clientY is 15
+PASS lastEvent.touches[0].identifier is 0
+PASS lastEvent.touches[1].pageX is 25
+PASS lastEvent.touches[1].pageY is 35
+PASS lastEvent.touches[1].clientX is 25
+PASS lastEvent.touches[1].clientY is 35
+PASS lastEvent.touches[1].identifier is 1
+PASS lastEvent.changedTouches[0].pageX is 15
+PASS lastEvent.changedTouches[0].pageY is 15
+PASS lastEvent.changedTouches[0].clientX is 15
+PASS lastEvent.changedTouches[0].clientY is 15
+PASS lastEvent.changedTouches[0].identifier is 0
+PASS lastEvent.changedTouches[1].pageX is 25
+PASS lastEvent.changedTouches[1].pageY is 35
+PASS lastEvent.changedTouches[1].clientX is 25
+PASS lastEvent.changedTouches[1].clientY is 35
+PASS lastEvent.changedTouches[1].identifier is 1
+PASS lastEvent.targetTouches[0].pageX is 15
+PASS lastEvent.targetTouches[0].pageY is 15
+PASS lastEvent.targetTouches[0].clientX is 15
+PASS lastEvent.targetTouches[0].clientY is 15
+PASS lastEvent.targetTouches[0].identifier is 0
+PASS lastEvent.targetTouches[1].pageX is 25
+PASS lastEvent.targetTouches[1].pageY is 35
+PASS lastEvent.targetTouches[1].clientX is 25
+PASS lastEvent.targetTouches[1].clientY is 35
+PASS lastEvent.targetTouches[1].identifier is 1
+PASS lastEvent.type is "touchend"
+PASS lastEvent.touches.length is 0
+PASS lastEvent.changedTouches.length is 2
+PASS lastEvent.targetTouches.length is 0
+PASS lastEvent.pageX is 0
+PASS lastEvent.pageY is 0
+PASS lastEvent.changedTouches[0].pageX is 15
+PASS lastEvent.changedTouches[0].pageY is 15
+PASS lastEvent.changedTouches[0].clientX is 15
+PASS lastEvent.changedTouches[0].clientY is 15
+PASS lastEvent.changedTouches[0].identifier is 0
+PASS lastEvent.changedTouches[1].pageX is 25
+PASS lastEvent.changedTouches[1].pageY is 35
+PASS lastEvent.changedTouches[1].clientX is 25
+PASS lastEvent.changedTouches[1].clientY is 35
+PASS lastEvent.changedTouches[1].identifier is 1
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchbasicsingletoucheventsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-single-touch-events-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-single-touch-events-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/basic-single-touch-events-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,74 @@
</span><ins>+This tests basic single touch event support.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS lastEvent.type is "touchstart"
+PASS lastEvent.touches.length is 1
+PASS lastEvent.changedTouches.length is 1
+PASS lastEvent.targetTouches.length is 1
+FAIL lastEvent.pageX should be 0. Was 10.
+FAIL lastEvent.pageY should be 0. Was 10.
+PASS lastEvent.shiftKey is false
+PASS lastEvent.touches[0].target.id is "touchtarget"
+PASS lastEvent.touches[0].pageX is 10
+PASS lastEvent.touches[0].pageY is 10
+PASS lastEvent.touches[0].clientX is 10
+PASS lastEvent.touches[0].clientY is 10
+PASS lastEvent.touches[0].identifier is 0
+PASS lastEvent.changedTouches[0].pageX is 10
+PASS lastEvent.changedTouches[0].pageY is 10
+PASS lastEvent.changedTouches[0].clientX is 10
+PASS lastEvent.changedTouches[0].clientY is 10
+PASS lastEvent.changedTouches[0].identifier is 0
+PASS lastEvent.targetTouches[0].pageX is 10
+PASS lastEvent.targetTouches[0].pageY is 10
+PASS lastEvent.targetTouches[0].clientX is 10
+PASS lastEvent.targetTouches[0].clientY is 10
+PASS lastEvent.targetTouches[0].identifier is 0
+PASS lastEvent.type is "touchmove"
+PASS lastEvent.touches.length is 1
+PASS lastEvent.changedTouches.length is 1
+PASS lastEvent.targetTouches.length is 1
+FAIL lastEvent.pageX should be 0. Was 50.
+FAIL lastEvent.pageY should be 0. Was 50.
+PASS lastEvent.touches[0].pageX is 50
+PASS lastEvent.touches[0].pageY is 50
+PASS lastEvent.touches[0].clientX is 50
+PASS lastEvent.touches[0].clientY is 50
+PASS lastEvent.touches[0].identifier is 0
+PASS lastEvent.shiftKey is true
+PASS lastEvent.altKey is true
+PASS lastEvent.ctrlKey is false
+PASS lastEvent.metaKey is false
+PASS lastEvent.type is "touchend"
+PASS lastEvent.touches.length is 0
+PASS lastEvent.changedTouches.length is 1
+PASS lastEvent.targetTouches.length is 0
+PASS lastEvent.pageX is 0
+PASS lastEvent.pageY is 0
+PASS lastEvent.changedTouches[0].pageX is 50
+PASS lastEvent.changedTouches[0].pageY is 50
+PASS lastEvent.changedTouches[0].clientX is 50
+PASS lastEvent.changedTouches[0].clientY is 50
+PASS lastEvent.changedTouches[0].identifier is 0
+PASS lastEvent.shiftKey is false
+PASS lastEvent.altKey is false
+PASS lastEvent.type is "touchstart"
+PASS lastEvent.touches.length is 1
+PASS lastEvent.changedTouches.length is 1
+PASS lastEvent.targetTouches.length is 1
+FAIL lastEvent.pageX should be 0. Was 20.
+FAIL lastEvent.pageY should be 0. Was 20.
+PASS lastEvent.targetTouches[0].target.tagName is "DIV"
+PASS lastEvent.type is "touchmove"
+PASS lastEvent.touches.length is 1
+PASS lastEvent.changedTouches.length is 1
+PASS lastEvent.targetTouches.length is 1
+FAIL lastEvent.pageX should be 0. Was 1000.
+FAIL lastEvent.pageY should be 0. Was 1000.
+PASS lastEvent.touches[0].target.tagName is "DIV"
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchdocumentcreatetouchexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/document-create-touch-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/document-create-touch-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/document-create-touch-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,19 @@
</span><ins>+CONSOLE MESSAGE: line 25: TypeError: Not enough arguments
+This tests support for the document.createTouch API.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS "createTouch" in document is true
+PASS touch is non-null.
+PASS touch.target is box
+PASS touch.identifier is 1
+PASS touch.pageX is 100
+PASS touch.pageY is 101
+PASS touch.screenX is 102
+PASS touch.screenY is 103
+FAIL touch.webkitRadiusX should be 5 (of type number). Was undefined (of type undefined).
+FAIL touch.webkitRadiusY should be 3 (of type number). Was undefined (of type undefined).
+FAIL touch.webkitRotationAngle should be 10 (of type number). Was undefined (of type undefined).
+FAIL touch.webkitForce should be 10 (of type number). Was undefined (of type undefined).
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchdocumentcreatetouchlistexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/document-create-touch-list-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/document-create-touch-list-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/document-create-touch-list-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,16 @@
</span><ins>+This tests support for the document.createTouchList API.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS "createTouchList" in document is true
+PASS touchList is non-null.
+PASS touchList.length is 0
+PASS touchList.item(0) is null
+PASS touchList.item(1) is null
+PASS touchList.item() threw exception TypeError: Not enough arguments.
+FAIL An exception was thrown: Type error
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchemulatetoucheventsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/emulate-touch-events-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/emulate-touch-events-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/emulate-touch-events-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+This tests single touch event emulation using mouse events.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS 'ontouchstart' in window is true
+PASS 'ontouchend' in document is true
+Unexpected mousemove event received before touchstart
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchemulatedtouchiframeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/emulated-touch-iframe-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/emulated-touch-iframe-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/emulated-touch-iframe-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+
+Test touchend events are emulated in iframes correctly.
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchframehoverupdateexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/frame-hover-update-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/frame-hover-update-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/frame-hover-update-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,21 @@
</span><ins>+PASS [object HTMLDocument] is non-null.
+PASS [object HTMLDocument] is non-null.
+PASS hoveredTop.length is 1
+PASS hoveredIframe1.length is 1
+PASS hoveredIframe2.length is 0
+PASS hoveredTop.length is 1
+PASS hoveredIframe1.length is 0
+PASS hoveredIframe2.length is 1
+FAIL hoveredTop.length should be 0. Was 1.
+PASS hoveredIframe1.length is 0
+PASS hoveredIframe2.length is 0
+PASS hoveredTop.length is 1
+PASS hoveredIframe1.length is 0
+FAIL hoveredIframe2.length should be 0. Was 1.
+PASS hoveredTop.length is 1
+PASS hoveredIframe1.length is 0
+FAIL hoveredIframe2.length should be 0. Was 1.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturecontextmenuonlongpressexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-long-press-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-long-press-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-long-press-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+gestureLongPress not implemented by this platform
+This test checks that the context menu is shown on long press gesture.
+
+Testing
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturecontextmenuonlongtapexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-long-tap-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-long-tap-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-long-tap-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+gestureLongTap not implemented by this platform
+This test checks that the context menu is shown on long tap gesture.
+
+Testing
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturecontextmenuontwofingertapexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-two-finger-tap-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-two-finger-tap-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/context-menu-on-two-finger-tap-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+gestureTwoFingerTap not implemented by this platform
+This test checks that the context menu is shown on a two finger tap gesture.
+
+Testing
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturegestureclickexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-click-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-click-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-click-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+CONSOLE MESSAGE: line 69: TypeError: undefined is not a function (evaluating 'eventSender.gestureTap(10, 12)')
+FAIL: Timed out waiting for notifyDone to be called
+This tests basic gesture callbacks.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturegesturedblclickexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-dblclick-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-dblclick-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-dblclick-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+CONSOLE MESSAGE: line 75: TypeError: undefined is not a function (evaluating 'eventSender.gestureTap(10, 12)')
+FAIL: Timed out waiting for notifyDone to be called
+This tests gesture callbacks for a double tap sequence of gestures.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturegesturescrollexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-scroll-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-scroll-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-scroll-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,9 @@
</span><ins>+CONSOLE MESSAGE: line 98: TypeError: undefined is not a function (evaluating 'eventSender.gestureScrollBegin(95, 12)')
+FAIL: Timed out waiting for notifyDone to be called
+This tests scroll gesture events. Square is (mostly) green on pass
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+first gesture
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturegesturescrollbarexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-scrollbar-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-scrollbar-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-scrollbar-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+CONSOLE MESSAGE: line 50: TypeError: undefined is not a function (evaluating 'eventSender.gestureTapDown(scrollbarX, scrollbarY)')
+This tests scroll gesture events on a scroll bar. The scrollable div below should be slightly scrolled down if successful.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS movingDiv.scrollTop is 0
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturegesturetapactivestateiframeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-tap-active-state-iframe-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-tap-active-state-iframe-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/gesture-tap-active-state-iframe-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,11 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+
+Tests that tap gesture events set and clear the active state of elements, even when inside an iframe and the document is scrolled.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+See https://bugs.webkit.org/show_bug.cgi?id=96060 for details
+
+GestureTapDown is not supported by this platform
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturelongpressondraggableelementiniframetriggersdragexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-in-iframe-triggers-drag-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-in-iframe-triggers-drag-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-in-iframe-triggers-drag-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,7 @@
</span><ins>+CONSOLE MESSAGE: line 24: TypeError: undefined is not a function (evaluating 'internals.settings.setTouchDragDropEnabled(true)')
+FAIL: Timed out waiting for notifyDone to be called
+
+This test checks that a long press gesture on a draggable element in an iframe starts a drag/drop session.
+
+Testing
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturelongpressondraggableelementinnestediframestriggersdragexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-in-nested-iframes-triggers-drag-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-in-nested-iframes-triggers-drag-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-in-nested-iframes-triggers-drag-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,7 @@
</span><ins>+CONSOLE MESSAGE: line 24: TypeError: undefined is not a function (evaluating 'internals.settings.setTouchDragDropEnabled(true)')
+FAIL: Timed out waiting for notifyDone to be called
+
+This test checks that a long press gesture on a draggable element in an iframe starts a drag/drop session.
+
+Testing
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturelongpressondraggableelementtriggersdragexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-triggers-drag-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-triggers-drag-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/long-press-on-draggable-element-triggers-drag-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,6 @@
</span><ins>+CONSOLE MESSAGE: line 18: TypeError: undefined is not a function (evaluating 'internals.settings.setTouchDragDropEnabled(true)')
+This test checks that a long press gesture on a draggable element starts a drag/drop session.
+
+Testing
+FAIL
+Drag me
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturepadgesturecancelexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/pad-gesture-cancel-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/pad-gesture-cancel-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/pad-gesture-cancel-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+Tests basic use of GestureFlingCancel
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS actualWheelEventsOccurred is 0
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturerightclickgesturessetcursoratcorrectpositionexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/right-click-gestures-set-cursor-at-correct-position-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/right-click-gestures-set-cursor-at-correct-position-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/right-click-gestures-set-cursor-at-correct-position-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,6 @@
</span><ins>+CONSOLE MESSAGE: line 53: ReferenceError: Can't find variable: debug
+This test checks that on a long press or a two finger tap gesture in a text area, the cursor is first set to the right position (this is done by sending a right mouse button down event just before long press).
+
+
+Testing
+FAIL
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrolldivnotpropagatedexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-not-propagated-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-not-propagated-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-not-propagated-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+This tests that a gesture scroll is not propagated from an inner div to an outer div when the inner div has no remaining scroll offset when the GestureScrollUpdateWithoutPropagation event type is used.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+gesture events not implemented on this platform or gesture event scrolling of a document is broken
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrolldivpropagatedexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-propagated-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-propagated-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-propagated-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+This tests that a gesture scroll is propagated from an inner div to an outer div when the inner div has no remaining scroll offset.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+gesture events not implemented on this platform or gesture event scrolling of a document is broken
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrolldivtwicepropagatedexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-twice-propagated-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-twice-propagated-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-div-twice-propagated-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+This tests that a gesture scroll is propagated from an inner div to an outer div twice when the scrolled divs have no remaining scroll offset.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+gesture events not implemented on this platform or gesture event scrolling of a document is broken
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrolliframeeditableexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-iframe-editable-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-iframe-editable-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-iframe-editable-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,11 @@
</span><ins>+
+This tests gesture event scrolling of an iframe in an overflow div. Red-green strip is scrolled on pass.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+gesture events not implemented on this platform or gesture event scrolling of a document is broken
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrollpagenotpropagatedexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-page-not-propagated-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-page-not-propagated-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-page-not-propagated-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+This tests that a gesture scroll is not propagated from a div to the page when the div has no remaining scroll offset when the GestureScrollUpdateWithoutPropagation event type is used.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+gesture events not implemented on this platform or gesture event scrolling of a document is broken
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrollpagepropagatedexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-page-propagated-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-page-propagated-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-page-propagated-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+This tests that a gesture scroll is propagated from a div to the page when the div has no remaining scroll offset.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+gesture events not implemented on this platform or gesture event scrolling of a document is broken
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchgesturetouchgesturescrollsidewaysexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-sideways-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-sideways-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/gesture/touch-gesture-scroll-sideways-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+This tests that precise scrolls on a horizontal scroll bar move vertically.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+gesture events not implemented on this platform or gesture event scrolling of a document is broken
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchmultitouchgroupedtargetsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-grouped-targets-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-grouped-targets-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-grouped-targets-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,26 @@
</span><ins>+Tests that the an event is sent for every touch listener, and target touches contains all the points for that target
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+PASS event.touches.length is 3
+FAIL event.changedTouches.length should be 3. Was 1.
+PASS event.touches.length is 3
+FAIL event.changedTouches.length should be 3. Was 2.
+PASS event.touches.length is 3
+FAIL event.changedTouches.length should be 3. Was 1.
+PASS event.touches.length is 3
+FAIL event.changedTouches.length should be 3. Was 2.
+PASS event.type is "touchend"
+PASS event.touches.length is 0
+PASS event.targetTouches.length is 0
+FAIL event.changedTouches.length should be 3. Was 1.
+PASS event.type is "touchend"
+PASS event.touches.length is 0
+PASS event.targetTouches.length is 0
+FAIL event.changedTouches.length should be 3. Was 2.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchmultitouchinsideiframesexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-inside-iframes-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-inside-iframes-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-inside-iframes-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,70 @@
</span><ins>+
+Test multi-touch is sent to the same iframe.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+First touch is on iframe1.
+PASS document.elementFromPoint(101, 101).id is "iframe1"
+PASS ev.type is "touchstart"
+PASS touchreceiver is "iframe1"
+PASS ev.changedTouches.length is 1
+PASS ev.touches.length is 1
+PASS ev.targetTouches.length is 1
+PASS ev.touches[0].pageX is 50
+PASS ev.touches[0].pageY is 50
+PASS ev.touches[0].target.ownerDocument.title is "iframe1"
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe1"
+PASS ev.targetTouches[0].target.ownerDocument.title is "iframe1"
+
+Second touch is on iframe2, nothing should happen.
+PASS document.elementFromPoint(251, 101).id is "iframe2"
+
+Moves the first touch outside iframe1.
+PASS ev.type is "touchmove"
+PASS touchreceiver is "iframe1"
+PASS ev.changedTouches.length is 1
+PASS ev.touches.length is 1
+PASS ev.targetTouches.length is 1
+PASS ev.touches[0].pageX is 150
+PASS ev.touches[0].pageY is 150
+PASS ev.touches[0].target.ownerDocument.title is "iframe1"
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe1"
+PASS ev.targetTouches[0].target.ownerDocument.title is "iframe1"
+
+Release the first touch.
+PASS ev.type is "touchend"
+PASS touchreceiver is "iframe1"
+PASS ev.changedTouches.length is 1
+PASS ev.touches.length is 0
+PASS ev.targetTouches.length is 0
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe1"
+
+Third touch is on iframe2, nothing should happen.
+PASS document.elementFromPoint(261, 101).id is "iframe2"
+PASS ev.type is "touchstart"
+PASS touchreceiver is "iframe2"
+FAIL ev.changedTouches.length should be 1. Was 2.
+FAIL ev.touches.length should be 1. Was 2.
+FAIL ev.targetTouches.length should be 1. Was 2.
+PASS ev.touches[0].pageX is 50
+PASS ev.touches[0].pageY is 50
+PASS ev.touches[0].target.ownerDocument.title is "iframe2"
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe2"
+PASS ev.targetTouches[0].target.ownerDocument.title is "iframe2"
+
+Release all touches on iframe2, and touch iframe2 again.
+PASS ev.type is "touchend"
+PASS touchreceiver is "iframe2"
+FAIL ev.changedTouches.length should be 1. Was 2.
+PASS ev.touches.length is 0
+PASS ev.targetTouches.length is 0
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe2"
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
+Touch iframe1, nothing shoud happen.
+
+Release all touches.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchmultitouchinsidenestediframesexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-inside-nested-iframes-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-inside-nested-iframes-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/multi-touch-inside-nested-iframes-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,78 @@
</span><ins>+
+Test multi-touch is sent to the same iframe.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+First touch is on inner iframe.
+PASS ev.type is "touchstart"
+PASS touchreceiver is "iframe1"
+PASS ev.changedTouches.length is 1
+PASS ev.touches.length is 1
+PASS ev.targetTouches.length is 1
+PASS ev.touches[0].pageX is 50
+PASS ev.touches[0].pageY is 50
+PASS ev.touches[0].target.ownerDocument.title is "iframe1"
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe1"
+PASS ev.targetTouches[0].target.ownerDocument.title is "iframe1"
+
+Second touch is on outer iframe, nothing should happen.
+
+Moves the first touch outside inner iframe.
+PASS ev.type is "touchmove"
+PASS touchreceiver is "iframe1"
+PASS ev.changedTouches.length is 1
+PASS ev.touches.length is 1
+PASS ev.targetTouches.length is 1
+PASS ev.touches[0].pageX is 200
+PASS ev.touches[0].pageY is 200
+PASS ev.touches[0].target.ownerDocument.title is "iframe1"
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe1"
+PASS ev.targetTouches[0].target.ownerDocument.title is "iframe1"
+
+Release the first touch.
+PASS ev.type is "touchend"
+PASS touchreceiver is "iframe1"
+PASS ev.changedTouches.length is 1
+PASS ev.touches.length is 0
+PASS ev.targetTouches.length is 0
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe1"
+
+Third touch is on outer iframe, nothing should happen.
+PASS ev.type is "touchstart"
+PASS touchreceiver is "iframe2"
+FAIL ev.changedTouches.length should be 1. Was 2.
+FAIL ev.touches.length should be 1. Was 2.
+FAIL ev.targetTouches.length should be 1. Was 2.
+FAIL ev.touches[0].pageX should be 30. Was 20.
+FAIL ev.touches[0].pageY should be 30. Was 20.
+PASS ev.touches[0].target.ownerDocument.title is "iframe2"
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe2"
+PASS ev.targetTouches[0].target.ownerDocument.title is "iframe2"
+
+Release all touches on outer iframe, and touch outer iframe again.
+FAIL ev.type should be touchstart. Was touchend.
+PASS touchreceiver is "iframe2"
+FAIL ev.changedTouches.length should be 1. Was 2.
+FAIL ev.touches.length should be 2. Was 0.
+FAIL ev.targetTouches.length should be 1. Was 0.
+FAIL ev.touches[0].pageX should be 30. Threw exception TypeError: undefined is not an object (evaluating 'ev.touches[0].pageX')
+FAIL ev.touches[0].pageY should be 30. Threw exception TypeError: undefined is not an object (evaluating 'ev.touches[0].pageY')
+FAIL ev.touches[0].target.ownerDocument.title should be iframe2. Threw exception TypeError: undefined is not an object (evaluating 'ev.touches[0].target')
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe2"
+FAIL ev.targetTouches[0].target.ownerDocument.title should be iframe2. Threw exception TypeError: undefined is not an object (evaluating 'ev.targetTouches[0].target')
+FAIL ev.type should be touchend. Was touchstart.
+PASS touchreceiver is "iframe2"
+FAIL ev.changedTouches.length should be 2. Was 1.
+FAIL ev.touches.length should be 0. Was 1.
+FAIL ev.targetTouches.length should be 0. Was 1.
+PASS ev.changedTouches[0].target.ownerDocument.title is "iframe2"
+FAIL ev.changedTouches[1].target.ownerDocument.title should be iframe2. Threw exception TypeError: undefined is not an object (evaluating 'ev.changedTouches[1].target')
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
+Touch inner iframe, this will trigger onTouch as it is inside outer iframe.
+
+Release all touches.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchpagescaledtouchgestureclickexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/page-scaled-touch-gesture-click-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/page-scaled-touch-gesture-click-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/page-scaled-touch-gesture-click-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+CONSOLE MESSAGE: line 84: TypeError: undefined is not a function (evaluating 'eventSender.gestureTap(10, 12)')
+FAIL: Timed out waiting for notifyDone to be called
+This tests basic single touch gesture generation.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchtouchbeforepressingspinbuttonexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-before-pressing-spin-button-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-before-pressing-spin-button-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-before-pressing-spin-button-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+Test if a spin-button works correctly after touch events.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+FAIL numberInput.value should be 2. Was 1.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchtouchcoordsinzoomandscrollexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-coords-in-zoom-and-scroll-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-coords-in-zoom-and-scroll-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-coords-in-zoom-and-scroll-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,27 @@
</span><ins>+Base
+PASS event.touches[0].clientX is 100
+PASS event.touches[0].clientY is 100
+PASS event.touches[0].pageX is 100
+PASS event.touches[0].pageY is 100
+
+Just zoomed
+FAIL event.touches[0].clientX should be 83. Was 100.
+FAIL event.touches[0].clientY should be 83. Was 100.
+FAIL event.touches[0].pageX should be 83. Was 100.
+FAIL event.touches[0].pageY should be 83. Was 100.
+
+Just scrolled
+PASS event.touches[0].clientX is 100
+PASS event.touches[0].clientY is 100
+FAIL event.touches[0].pageX should be 150. Was 100.
+FAIL event.touches[0].pageY should be 150. Was 100.
+
+Zoomed and scrolled
+FAIL event.touches[0].clientX should be 84. Was 100.
+FAIL event.touches[0].clientY should be 84. Was 100.
+FAIL event.touches[0].pageX should be 133. Was 100.
+FAIL event.touches[0].pageY should be 133. Was 100.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchtouchinputelementchangedocumentsexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-input-element-change-documents-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-input-element-change-documents-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-input-element-change-documents-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,12 @@
</span><ins>+This test checks that we correctly update the touch event handler count when an Input element with default touch handlers changes documents.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS window.internals.touchEventHandlerCount() is 0
+PASS window.internals.touchEventHandlerCount() is 0
+FAIL window.internals.touchEventHandlerCount() should be 2. Was 16.
+FAIL window.internals.touchEventHandlerCount() should be 3. Was 17.
+FAIL window.internals.touchEventHandlerCount() should be 2. Was 16.
+FAIL window.internals.touchEventHandlerCount() should be 0. Was 6.
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchtouchinsideiframescrolledexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-inside-iframe-scrolled-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-inside-iframe-scrolled-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-inside-iframe-scrolled-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,8 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+
+Test iframes receive touches correctly when scrolled. https://bugs.webkit.org/show_bug.cgi?id=96541
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchtouchscaledscrolledexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-scaled-scrolled-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-scaled-scrolled-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-scaled-scrolled-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+This test is successful if event.clientX/Y are consistent with the generated input.
+30, 70
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchtouchsliderexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-slider-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-slider-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-slider-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,28 @@
</span><ins>+Tests that the touch events originating on an input element with type=range update the slider position. This test is only expected to pass if ENABLE_TOUCH_SLIDER is defined.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+PASS event.touches[0].target.id is "slider1"
+PASS sliderValue is "50"
+PASS sliderValue is "50"
+FAIL sliderValue should be 0. Was 50.
+FAIL sliderValue should be 100. Was 50.
+PASS sliderValue is "50"
+PASS event.touches[0].target.id is "slider2"
+PASS sliderValue is "50"
+PASS sliderValue is "50"
+PASS sliderValue is "0"
+PASS sliderValue is "100"
+PASS sliderValue is "50"
+PASS event.touches[0].target.id is "slider3"
+PASS sliderValue is "50"
+PASS sliderValue is "50"
+PASS sliderValue is "0"
+PASS sliderValue is "100"
+PASS sliderValue is "50"
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventstouchtouchslidernojstouchlistenerexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-slider-no-js-touch-listener-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-slider-no-js-touch-listener-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/touch/touch-slider-no-js-touch-listener-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,12 @@
</span><ins>+Tests to ensure that touch events are delivered to an input element with type=range even when there are no touch event handlers in Javascript. This test is only expected to pass if ENABLE_TOUCH_SLIDER is defined.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
+PASS slider.value is "50"
+FAIL slider.value should be 0. Was 50.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventsupdateLayoutForHitTestexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/updateLayoutForHitTest-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/updateLayoutForHitTest-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/updateLayoutForHitTest-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,17 @@
</span><ins>+CONSOLE MESSAGE: line 36: TypeError: null is not an object (evaluating 'triangleSpan.nextSibling.nextSibling.nextSibling.nextSibling.style')
+CONSOLE MESSAGE: line 40: TypeError: null is not an object (evaluating 'triangleSpan.nextSibling.nextSibling.nextSibling.nextSibling.style')
+CONSOLE MESSAGE: line 36: TypeError: null is not an object (evaluating 'triangleSpan.nextSibling.nextSibling.nextSibling.nextSibling.style')
+CONSOLE MESSAGE: line 40: TypeError: null is not an object (evaluating 'triangleSpan.nextSibling.nextSibling.nextSibling.nextSibling.style')
+layer at (0,0) size 800x600
+ RenderView at (0,0) size 800x600
+layer at (0,0) size 800x600
+ RenderBlock {HTML} at (0,0) size 800x600
+ RenderBody {BODY} at (8,8) size 784x584
+ RenderBlock (floating) {DIV} at (5,5) size 68x33 [bgcolor=#ADD8E6]
+ RenderInline {SPAN} at (0,0) size 9x19
+ RenderText {#text} at (5,8) size 9x19
+ text run at (5,8) width 9: "\x{25B8}"
+ RenderText {#text} at (13,8) size 50x19
+ text run at (13,8) width 50: " Project"
+ RenderText {#text} at (0,0) size 0x0
+caret: position 0 of child 0 {#text} of child 1 {SPAN} of child 3 {DIV} of body
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventswheeleventbasicexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-basic-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-basic-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-basic-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,28 @@
</span><ins>+TOP TOP TOP TOP TOP TOP TOP TOP TOP TOP TOP TOP TOP TOP
+Scroll mouse wheel over here
+Scroll mouse wheel over here
+Scroll mouse wheel over here
+Scroll mouse wheel over here
+Scroll mouse wheel over here
+Scroll mouse wheel over here
+END END END END END END END END END END END END END END
+Tests the basic functionality of the standard wheel event
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS WheelEvent.prototype.__proto__ is MouseEvent.prototype
+PASS WheelEvent.DOM_DELTA_PIXEL is 0x00
+PASS WheelEvent.DOM_DELTA_LINE is 0x01
+PASS WheelEvent.DOM_DELTA_PAGE is 0x02
+PASS window.onwheel is null
+PASS document.onwheel is null
+PASS testDiv.onwheel is null
+FAIL deltaX > 0 should be true. Was false.
+PASS deltaX is expectedDeltaX
+FAIL deltaY > 0 should be true. Was false.
+PASS deltaY is expectedDeltaY
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventswheeleventdirectioninvertedfromdeviceexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-direction-inverted-from-device-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-direction-inverted-from-device-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-direction-inverted-from-device-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,12 @@
</span><ins>+This test checks for the existence of the webkitDirectionInvertedFromDevice property in the WheelEvent.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+Scroll over me
+sending scroll event to green target
+FAIL result != undefined should be true. Was false.
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventswheeleventinhorizontalscrollbarinrtlexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-horizontal-scrollbar-in-rtl-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-horizontal-scrollbar-in-rtl-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-horizontal-scrollbar-in-rtl-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat. Duis aute irure dolor in reprehenderit in voluptate velit esse cillum dolore eu fugiat nulla pariatur. Excepteur sint occaecat cupidatat non proident, sunt in culpa qui officia deserunt mollit anim id est laborum."
+window.scrollX: -3202
+window.scrollY: 0
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventswheeleventintextnodeexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-text-node-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-text-node-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-text-node-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,2 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+This is a div containing text. Wheel events originating on the text node should target the div.
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventswheeleventinverticalscrollbarinrtlexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-vertical-scrollbar-in-rtl-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-vertical-scrollbar-in-rtl-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-in-vertical-scrollbar-in-rtl-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,3 @@
</span><ins>+Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat. Duis aute irure dolor in reprehenderit in voluptate velit esse cillum dolore eu fugiat nulla pariatur. Excepteur sint occaecat cupidatat non proident, sunt in culpa qui officia deserunt mollit anim id est laborum."
+window.scrollX: 0
+window.scrollY: -402
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventswheeleventmousewheelinteractionexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-mousewheel-interaction-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-mousewheel-interaction-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/wheelevent-mousewheel-interaction-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,10 @@
</span><ins>+Tests the interaction between the standard 'wheel' event and the non-standard 'mousewheel' one
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+PASS successfullyParsed is true
+
+TEST COMPLETE
+TOP TOP TOP TOP TOP TOP TOP Scroll mouse wheel over here Scroll mouse wheel over here Scroll mouse wheel over here Scroll mouse wheel over here Scroll mouse wheel over here Scroll mouse wheel over here END END END END END END END
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventswillrevealedgesbodyattributesexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-body-attributes-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-body-attributes-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-body-attributes-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,7 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+This tests that onwebkitwillrevealbottom, onwebkitwillrevealtop, onwebkitwillrevealleft, and onwebkitwillrevealright work as body attributes
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventswillrevealedgeseventlistenersexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-event-listeners-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-event-listeners-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-event-listeners-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,7 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+This tests that we can listen for webkitwillrevealbottom, webkitwillrevealtop, webkitwillrevealleft, and webkitwillrevealright
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventswillrevealedgeswindowattributesexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-window-attributes-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-window-attributes-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/will-reveal-edges-window-attributes-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,7 @@
</span><ins>+FAIL: Timed out waiting for notifyDone to be called
+This tests that onwebkitwillrevealbottom, onwebkitwillrevealtop, onwebkitwillrevealleft, and onwebkitwillrevealright work as window attributes.
+
+On success, you will see a series of "PASS" messages, followed by "TEST COMPLETE".
+
+
+
</ins></span></pre></div>
<a id="trunkLayoutTestsplatformiossimulatorfasteventszoomdblclickexpectedtxt"></a>
<div class="addfile"><h4>Added: trunk/LayoutTests/platform/ios-simulator/fast/events/zoom-dblclick-expected.txt (0 => 174618)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/LayoutTests/platform/ios-simulator/fast/events/zoom-dblclick-expected.txt (rev 0)
+++ trunk/LayoutTests/platform/ios-simulator/fast/events/zoom-dblclick-expected.txt 2014-10-10 23:04:22 UTC (rev 174618)
</span><span class="lines">@@ -0,0 +1,5 @@
</span><ins>+
+PASS successfullyParsed is true
+
+TEST COMPLETE
+
</ins></span></pre>
</div>
</div>
</body>
</html>